Lus10006173 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G71450 129 / 2e-38 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT1G33760 97 / 8e-26 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT4G16750 94 / 2e-24 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT1G77200 94 / 1e-23 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT5G11590 93 / 1e-23 AP2_ERF DREB3, TINY2 TINY2, Integrase-type DNA-binding superfamily protein (.1)
AT2G35700 92 / 1e-23 AP2_ERF ATERF38 ERF family protein 38 (.1)
AT5G25810 92 / 2e-23 AP2_ERF TNY, TINY TINY, Integrase-type DNA-binding superfamily protein (.1)
AT3G16280 91 / 1e-22 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT4G32800 89 / 4e-22 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT1G01250 87 / 8e-22 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041050 227 / 1e-76 AT1G71450 189 / 1e-61 Integrase-type DNA-binding superfamily protein (.1)
Lus10007799 101 / 7e-28 AT2G44940 136 / 7e-42 Integrase-type DNA-binding superfamily protein (.1)
Lus10004738 102 / 2e-27 AT2G35700 144 / 7e-44 ERF family protein 38 (.1)
Lus10041052 102 / 2e-27 AT1G33760 143 / 3e-43 Integrase-type DNA-binding superfamily protein (.1)
Lus10002801 92 / 6e-23 AT5G11590 209 / 4e-68 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Lus10011123 89 / 1e-22 AT5G11590 143 / 6e-43 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Lus10034949 92 / 2e-22 AT4G32800 169 / 3e-51 Integrase-type DNA-binding superfamily protein (.1)
Lus10043240 91 / 2e-22 AT5G11590 176 / 1e-54 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Lus10038270 85 / 1e-20 AT5G11590 168 / 4e-52 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G101100 133 / 8e-40 AT1G71450 184 / 1e-59 Integrase-type DNA-binding superfamily protein (.1)
Potri.019G075500 131 / 5e-39 AT1G71450 200 / 5e-66 Integrase-type DNA-binding superfamily protein (.1)
Potri.001G181500 123 / 4e-36 AT1G71450 184 / 8e-60 Integrase-type DNA-binding superfamily protein (.1)
Potri.019G075600 104 / 1e-28 AT1G33760 147 / 6e-45 Integrase-type DNA-binding superfamily protein (.1)
Potri.013G101200 103 / 2e-28 AT1G33760 149 / 1e-45 Integrase-type DNA-binding superfamily protein (.1)
Potri.001G155700 103 / 3e-27 AT2G44940 159 / 1e-47 Integrase-type DNA-binding superfamily protein (.1)
Potri.003G079300 101 / 8e-27 AT4G16750 150 / 7e-46 Integrase-type DNA-binding superfamily protein (.1)
Potri.003G054100 98 / 6e-26 AT1G71450 144 / 8e-44 Integrase-type DNA-binding superfamily protein (.1)
Potri.018G043900 91 / 2e-22 AT5G11590 212 / 5e-69 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Potri.001G187500 90 / 2e-22 AT5G25810 157 / 9e-48 TINY, Integrase-type DNA-binding superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0081 MBD-like PF00847 AP2 AP2 domain
Representative CDS sequence
>Lus10006173 pacid=23148571 polypeptide=Lus10006173 locus=Lus10006173.g ID=Lus10006173.BGIv1.0 annot-version=v1.0
ATGAGCAATGGCGGCGGCTCAGGGACTCCCTCGTGCTACAGAGGGGTCCGGAAGCGGAAATGGGGGAAATGGGTGTCCGAAATCCGTGAGCCTGGCACCA
AAACGAGAGTTTGGCTGGGAAGCTTCGACACGCCGGAGATGGCTGCTGCGGCGTACGACGCCGCCGCGCTGTACTTTAGGGGACCGGAAGCAAGGCTGAA
CTTCCCTGAGGTGGCCCATTGCTTGCCTAGGCCCGAGAGCTCGAGCCCGGACGATATTAGGAGGGCGGCCCATGAAGCGGCTATTCGTGCTGGGCCCATG
GACTGGTCTGGAGACTCTTCGTTTAATGTGGGTGGGGATTCCGGTTCAGGCTCCGGTGCCGTTGATGATGAGTCGGGTGGACCGAATGTCGGCCCGGTGA
CGGCGATCAACGAGTCGCCGATGGACTCGCCGCAGAGGTGGATGATGGACTATTCGACGATGTACATGAATGACGTGGAGTGGCAGGATTACGGTCACAG
TGATTCTCTATGGGATCCTTAA
AA sequence
>Lus10006173 pacid=23148571 polypeptide=Lus10006173 locus=Lus10006173.g ID=Lus10006173.BGIv1.0 annot-version=v1.0
MSNGGGSGTPSCYRGVRKRKWGKWVSEIREPGTKTRVWLGSFDTPEMAAAAYDAAALYFRGPEARLNFPEVAHCLPRPESSSPDDIRRAAHEAAIRAGPM
DWSGDSSFNVGGDSGSGSGAVDDESGGPNVGPVTAINESPMDSPQRWMMDYSTMYMNDVEWQDYGHSDSLWDP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G71450 AP2_ERF Integrase-type DNA-binding sup... Lus10006173 0 1
AT4G32290 Core-2/I-branching beta-1,6-N-... Lus10001503 10.7 0.7451
AT3G26880 Plant self-incompatibility pro... Lus10025935 11.3 0.7217
AT4G32090 Beta-1,3-N-Acetylglucosaminylt... Lus10012177 12.8 0.7513
AT5G56550 ATOXS3 oxidative stress 3 (.1) Lus10043039 14.5 0.7431
AT1G53210 sodium/calcium exchanger famil... Lus10028144 14.7 0.7318
AT3G06500 A/N-InvC alkaline/neutral invertase C, ... Lus10017095 23.6 0.7421
AT1G26850 S-adenosyl-L-methionine-depend... Lus10008619 24.4 0.7301
Lus10002746 28.0 0.6874
AT1G72100 late embryogenesis abundant do... Lus10000723 28.0 0.7254
AT1G68840 AP2_ERF EDF2, RAV2, RAP... TEMPRANILLO 2, RELATED TO AP2 ... Lus10034276 28.6 0.6674

Lus10006173 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.