Lus10006179 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G71520 107 / 1e-30 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT1G22810 100 / 7e-28 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT1G74930 89 / 4e-23 AP2_ERF ORA47, ERF018 Integrase-type DNA-binding superfamily protein (.1)
AT1G19210 87 / 4e-22 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT1G21910 80 / 4e-19 AP2_ERF DREB26 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1)
AT1G71450 77 / 2e-18 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT5G67190 77 / 2e-18 AP2_ERF DEAR2 DREB and EAR motif protein 2 (.1)
AT3G50260 76 / 3e-18 AP2_ERF DEAR1, CEJ1, ATERF#011 DREB AND EAR MOTIF PROTEIN 1, cooperatively regulated by ethylene and jasmonate 1 (.1)
AT4G36900 76 / 7e-18 AP2_ERF DEAR4, RAP2.10 DREB AND EAR MOTIF PROTEIN 4, related to AP2 10 (.1)
AT5G21960 76 / 2e-17 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041044 164 / 8e-53 AT1G71520 138 / 9e-43 Integrase-type DNA-binding superfamily protein (.1)
Lus10009468 123 / 4e-37 AT1G22810 132 / 1e-40 Integrase-type DNA-binding superfamily protein (.1)
Lus10038082 86 / 3e-21 AT5G21960 155 / 3e-47 Integrase-type DNA-binding superfamily protein (.1)
Lus10009798 82 / 1e-20 AT1G19210 132 / 1e-39 Integrase-type DNA-binding superfamily protein (.1)
Lus10033420 81 / 1e-19 AT1G19210 181 / 4e-58 Integrase-type DNA-binding superfamily protein (.1)
Lus10038607 79 / 3e-19 AT5G11590 168 / 1e-52 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Lus10034885 78 / 2e-18 AT1G19210 172 / 2e-54 Integrase-type DNA-binding superfamily protein (.1)
Lus10009373 76 / 4e-18 AT5G67190 164 / 3e-52 DREB and EAR motif protein 2 (.1)
Lus10018727 73 / 7e-17 AT5G67190 162 / 1e-51 DREB and EAR motif protein 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G100300 116 / 5e-34 AT1G22810 140 / 5e-43 Integrase-type DNA-binding superfamily protein (.1)
Potri.019G073300 116 / 1e-33 AT1G22810 144 / 1e-44 Integrase-type DNA-binding superfamily protein (.1)
Potri.006G218200 88 / 3e-22 AT1G19210 176 / 4e-56 Integrase-type DNA-binding superfamily protein (.1)
Potri.006G138700 83 / 2e-20 AT1G19210 174 / 1e-55 Integrase-type DNA-binding superfamily protein (.1)
Potri.006G138800 83 / 2e-20 AT1G19210 189 / 3e-61 Integrase-type DNA-binding superfamily protein (.1)
Potri.018G047300 82 / 2e-20 AT1G19210 169 / 1e-53 Integrase-type DNA-binding superfamily protein (.1)
Potri.002G085600 76 / 8e-18 AT1G77640 127 / 3e-36 Integrase-type DNA-binding superfamily protein (.1)
Potri.003G050700 76 / 2e-17 AT5G11590 166 / 5e-51 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Potri.005G176000 75 / 2e-17 AT1G21910 140 / 3e-41 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1)
Potri.013G101100 74 / 3e-17 AT1G71450 184 / 1e-59 Integrase-type DNA-binding superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0081 MBD-like PF00847 AP2 AP2 domain
Representative CDS sequence
>Lus10006179 pacid=23148540 polypeptide=Lus10006179 locus=Lus10006179.g ID=Lus10006179.BGIv1.0 annot-version=v1.0
ATGAGCAGCAGCACCGGCGATAAGAAATATAAAGGGGTCCGCCGCCGGAAATGGGGGAAATGGGTGTCAGAAATCCGGGTCCCCGGATCCCAGGAGCGGC
TCTGGCTCGGGTCTTATTCTTCGCCTGAGGCTGCCGCCGTCGCCCACGACATTGCTTACTATTGCCTGCGGCGGGGCGATACGTCTTCGTTGTCGTCGGC
GGGGAGGTGCTGCAATTTCCCACTAGCGTCATTGCCGACGAGCGTGCTCCGGCCTGATTTGTCGCCGAAGTCCGTCCAGAGGGCGGCTTCAGATGCCGGA
ATGGCGGGGGGGGGGGGGGGGGGCGCGCGGGACGAGGGCTGGATTTGTCGCCCGAGTCCGGCCAGGGGGCGGCTTCAGATGCCGGAAGGGCGGTGGACGC
GCAGCTGA
AA sequence
>Lus10006179 pacid=23148540 polypeptide=Lus10006179 locus=Lus10006179.g ID=Lus10006179.BGIv1.0 annot-version=v1.0
MSSSTGDKKYKGVRRRKWGKWVSEIRVPGSQERLWLGSYSSPEAAAVAHDIAYYCLRRGDTSSLSSAGRCCNFPLASLPTSVLRPDLSPKSVQRAASDAG
MAGGGGGGARDEGWICRPSPARGRLQMPEGRWTRS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G71520 AP2_ERF Integrase-type DNA-binding sup... Lus10006179 0 1
AT4G21700 Protein of unknown function (D... Lus10030937 20.0 0.6616
AT2G05830 NagB/RpiA/CoA transferase-like... Lus10001970 23.2 0.6646
AT3G51810 AT3, GEA1, ATEM... GUANINE NUCLEOTIDE EXCHANGE FA... Lus10000125 38.7 0.5338
AT5G10840 Endomembrane protein 70 protei... Lus10010683 55.3 0.5376
AT5G57550 XTR3, XTH25, EX... xyloglucan endotransglycosylas... Lus10012834 70.8 0.5559
AT4G08850 Leucine-rich repeat receptor-l... Lus10020936 79.1 0.5782
AT3G15280 unknown protein Lus10005404 133.4 0.5609
AT3G46790 CRR2 CHLORORESPIRATORY REDUCTION 2,... Lus10001557 148.9 0.5519
AT4G10265 Wound-responsive family protei... Lus10039760 181.3 0.5320
AT1G70140 ATFH8 formin 8 (.1) Lus10004244 185.5 0.5196

Lus10006179 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.