Lus10006680 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G26330 93 / 4e-24 Cupredoxin superfamily protein (.1)
AT3G17675 89 / 2e-23 Cupredoxin superfamily protein (.1)
AT2G26720 86 / 3e-21 Cupredoxin superfamily protein (.1)
AT2G31050 84 / 2e-20 Cupredoxin superfamily protein (.1)
AT2G32300 84 / 5e-20 UCC1 uclacyanin 1 (.1)
AT2G02850 79 / 3e-19 ARPN plantacyanin (.1)
AT4G12880 77 / 3e-18 AtENODL19 early nodulin-like protein 19 (.1.2)
AT5G20230 75 / 5e-17 SAG14, ATBCB SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
AT5G15350 71 / 8e-16 AtENODL17 early nodulin-like protein 17 (.1)
AT5G53870 74 / 1e-15 AtENODL1 early nodulin-like protein 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007025 225 / 4e-76 AT2G32300 101 / 3e-27 uclacyanin 1 (.1)
Lus10007027 194 / 7e-64 AT5G26330 100 / 5e-27 Cupredoxin superfamily protein (.1)
Lus10007026 184 / 6e-60 AT2G32300 96 / 4e-25 uclacyanin 1 (.1)
Lus10006682 182 / 3e-59 AT2G32300 95 / 1e-24 uclacyanin 1 (.1)
Lus10007028 179 / 4e-58 AT5G26330 92 / 8e-24 Cupredoxin superfamily protein (.1)
Lus10006683 132 / 9e-40 AT5G26330 88 / 1e-22 Cupredoxin superfamily protein (.1)
Lus10006681 122 / 5e-36 AT2G32300 59 / 2e-12 uclacyanin 1 (.1)
Lus10002615 105 / 2e-29 AT5G26330 96 / 9e-26 Cupredoxin superfamily protein (.1)
Lus10002617 105 / 5e-28 AT3G53330 105 / 1e-26 plastocyanin-like domain-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G061300 110 / 2e-31 AT3G17675 102 / 1e-28 Cupredoxin superfamily protein (.1)
Potri.003G117900 107 / 6e-30 AT3G17675 108 / 6e-31 Cupredoxin superfamily protein (.1)
Potri.013G030000 107 / 7e-30 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.013G030450 107 / 8e-30 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.006G259101 96 / 3e-25 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1)
Potri.006G259000 95 / 5e-25 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1)
Potri.002G161300 95 / 7e-25 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1)
Potri.019G037800 91 / 1e-23 AT3G17675 98 / 4e-27 Cupredoxin superfamily protein (.1)
Potri.002G052500 91 / 1e-23 AT5G26330 130 / 9e-39 Cupredoxin superfamily protein (.1)
Potri.013G054500 89 / 1e-22 AT3G17675 91 / 3e-24 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10006680 pacid=23152192 polypeptide=Lus10006680 locus=Lus10006680.g ID=Lus10006680.BGIv1.0 annot-version=v1.0
ATGGCCTTGGCTAGCAACAAGATGACAGTGGTCTTGATGGTTGCGGTGGTTGTTGCGGTGGCAGCTGCTTTCGTTCCGACAACCTCGGCCGAGAAATACG
TGGTCGGGGATGGTGGTGGGTGGACCAACAAGGGCGTCGATTACAAAGCTTGGGCTGAGGGCAAAACGTTCTACGTTGGCGATTCCCTTGTTTTCAACTA
CGCTTCCGGAAACCACAACGTGATGAAGGTGAACGCGTCGGACTTCCTGGCGTGCACAAAGCCTCTTACCGGACCTCCTCCACTGACCTCGGGAGCTGAT
GAGGTTACGCTCCTAACAACTGGAAAGAAGTGGTACATTTGCGGCGCTACTGGCCACTGTGCTGCCGGTCAAAAGCTCGTGATCGCCGTTTCTGAGGGAG
CTGCGCCGGCACCAACACCCAACTCACCGCCCAACGCCGCCGTTGGAGGGATCGTCGGTATCGGATTTGCTGCCTCCATGATTGTTGGGGTTATTGGGAT
GGTCTTGTTCTGA
AA sequence
>Lus10006680 pacid=23152192 polypeptide=Lus10006680 locus=Lus10006680.g ID=Lus10006680.BGIv1.0 annot-version=v1.0
MALASNKMTVVLMVAVVVAVAAAFVPTTSAEKYVVGDGGGWTNKGVDYKAWAEGKTFYVGDSLVFNYASGNHNVMKVNASDFLACTKPLTGPPPLTSGAD
EVTLLTTGKKWYICGATGHCAAGQKLVIAVSEGAAPAPTPNSPPNAAVGGIVGIGFAASMIVGVIGMVLF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G26330 Cupredoxin superfamily protein... Lus10006680 0 1
Lus10002449 2.0 1.0000
AT1G64660 ATMGL methionine gamma-lyase (.1) Lus10001671 2.4 1.0000
AT5G42800 M318, TT3, DFR dihydroflavonol 4-reductase (.... Lus10006195 3.0 1.0000
AT5G19580 glyoxal oxidase-related protei... Lus10011111 3.5 1.0000
AT5G02230 Haloacid dehalogenase-like hyd... Lus10028107 4.2 1.0000
AT1G14220 Ribonuclease T2 family protein... Lus10015409 4.4 1.0000
AT1G18720 Protein of unknown function (D... Lus10001647 4.5 1.0000
AT1G34355 FHA ATPS1 PARALLEL SPINDLE 1, forkhead-a... Lus10028665 4.6 1.0000
AT1G45191 BGLU1 beta glucosidase 1, Glycosyl h... Lus10030372 4.7 1.0000
AT1G76250 unknown protein Lus10008273 5.4 1.0000

Lus10006680 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.