Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G17675 59 / 3e-12 Cupredoxin superfamily protein (.1) AT2G02850 56 / 1e-10 ARPN plantacyanin (.1) AT5G26330 56 / 1e-10 Cupredoxin superfamily protein (.1) AT2G32300 57 / 2e-10 UCC1 uclacyanin 1 (.1) AT2G26720 53 / 2e-09 Cupredoxin superfamily protein (.1) AT1G22480 52 / 3e-09 Cupredoxin superfamily protein (.1) AT1G72230 52 / 3e-09 Cupredoxin superfamily protein (.1) AT2G31050 52 / 8e-09 Cupredoxin superfamily protein (.1) AT5G20230 44 / 8e-06 SAG14, ATBCB SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1) AT2G27035 40 / 8e-05 AtENODL20 early nodulin-like protein 20 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007027 [exp] 142 / 7e-44 AT5G26330 100 / 5e-27 Cupredoxin superfamily protein (.1) Lus10006682 [exp] 132 / 2e-40 AT2G32300 95 / 1e-24 uclacyanin 1 (.1) Lus10007028 [exp] 129 / 7e-39 AT5G26330 92 / 8e-24 Cupredoxin superfamily protein (.1) Lus10007025 [exp] 129 / 8e-39 AT2G32300 101 / 3e-27 uclacyanin 1 (.1) Lus10007026 [exp] 121 / 5e-36 AT2G32300 96 / 4e-25 uclacyanin 1 (.1) Lus10006680 [exp] 119 / 4e-35 AT5G26330 98 / 6e-26 Cupredoxin superfamily protein (.1) Lus10006683 [exp] 96 / 5e-26 AT5G26330 88 / 1e-22 Cupredoxin superfamily protein (.1) Lus10002617 [exp] 74 / 2e-16 AT3G53330 105 / 1e-26 plastocyanin-like domain-containing protein (.1) Lus10020276 [exp] 72 / 1e-15 AT1G45063 116 / 9e-30 copper ion binding;electron carriers (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G030450 [exp] 75 / 1e-17 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1) Potri.013G030000 [exp] 75 / 1e-17 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1) Potri.003G117900 [exp] 74 / 3e-17 AT3G17675 108 / 6e-31 Cupredoxin superfamily protein (.1) Potri.013G061300 [exp] 73 / 3e-17 AT3G17675 102 / 1e-28 Cupredoxin superfamily protein (.1) Potri.008G151000 [exp] 60 / 5e-12 AT5G26330 183 / 2e-59 Cupredoxin superfamily protein (.1) Potri.001G209300 [exp] 58 / 1e-11 AT2G02850 155 / 4e-50 plantacyanin (.1) Potri.003G047300 [exp] 59 / 2e-11 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1) Potri.010G089900 [exp] 57 / 8e-11 AT5G26330 187 / 7e-61 Cupredoxin superfamily protein (.1) Potri.006G259101 [exp] 56 / 1e-10 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1) Potri.006G259000 [exp] 56 / 1e-10 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [flax] [poplar] CU_oxidase PF02298 [flax] [poplar] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Lus10006681 pacid=23152216 polypeptide=Lus10006681 locus=Lus10006681.g ID=Lus10006681.BGIv1.0 annot-version=v1.0 ATGTCGTCGGGGATGAAATCGGATGGACCAACAAGGGCGTCGATTACAAAGCTTGAGCCGAAGGCAAGAATGTTTAACTATGCGGCGGGAAATCACAACG TGATGAAGGTGAACGGGACAGACTTTCTGGCATGCACAAAGCCTCTCGGCGGATTTCCTCCACTAACTAGCGGAAAAGACGAGATCTCACTCCTAACTTC CGGGAGGAAGTGGTACATTTGCGGCGCTCCAGGCCACTGCGACGCTGGTAAAAAACTCGTCATCACTGTCTCCGACAACGGAGCTGCCTCTCCTGCACCA ACACCTAGCTCGCCATCCAATGCTGCGGCGGGAGGCATAGCTAGTATTGGATTTGTTGCGGCAGTTGCGGTTATTGGGATGCTATTGTTCTGA
AA sequence Show only first row Show all	>Lus10006681 pacid=23152216 polypeptide=Lus10006681 locus=Lus10006681.g ID=Lus10006681.BGIv1.0 annot-version=v1.0 MSSGMKSDGPTRASITKLEPKARMFNYAAGNHNVMKVNGTDFLACTKPLGGFPPLTSGKDEISLLTSGRKWYICGAPGHCDAGKKLVITVSDNGAASPAP TPSSPSNAAAGGIASIGFVAAVAVIGMLLF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G32300		UCC1	uclacyanin 1 (.1)		Lus10006681 [exp]	0	1

Compare expression of checked genes

Lus10006681 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.