Lus10006683 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G02850 85 / 2e-21 ARPN plantacyanin (.1)
AT3G17675 84 / 2e-21 Cupredoxin superfamily protein (.1)
AT5G26330 84 / 1e-20 Cupredoxin superfamily protein (.1)
AT2G26720 81 / 3e-19 Cupredoxin superfamily protein (.1)
AT2G32300 80 / 1e-18 UCC1 uclacyanin 1 (.1)
AT2G31050 79 / 2e-18 Cupredoxin superfamily protein (.1)
AT3G60270 74 / 1e-16 Cupredoxin superfamily protein (.1)
AT1G72230 72 / 4e-16 Cupredoxin superfamily protein (.1)
AT5G07475 72 / 5e-16 Cupredoxin superfamily protein (.1)
AT4G12880 69 / 2e-15 AtENODL19 early nodulin-like protein 19 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007025 142 / 1e-43 AT2G32300 101 / 3e-27 uclacyanin 1 (.1)
Lus10007027 142 / 2e-43 AT5G26330 100 / 5e-27 Cupredoxin superfamily protein (.1)
Lus10006682 139 / 2e-42 AT2G32300 95 / 1e-24 uclacyanin 1 (.1)
Lus10007026 137 / 9e-42 AT2G32300 96 / 4e-25 uclacyanin 1 (.1)
Lus10006680 135 / 5e-41 AT5G26330 98 / 6e-26 Cupredoxin superfamily protein (.1)
Lus10007028 135 / 1e-40 AT5G26330 92 / 8e-24 Cupredoxin superfamily protein (.1)
Lus10006681 96 / 6e-26 AT2G32300 59 / 2e-12 uclacyanin 1 (.1)
Lus10020276 99 / 8e-25 AT1G45063 116 / 9e-30 copper ion binding;electron carriers (.1.2)
Lus10002617 97 / 2e-24 AT3G53330 105 / 1e-26 plastocyanin-like domain-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G030450 112 / 5e-32 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.013G030000 112 / 1e-31 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.013G061300 109 / 7e-31 AT3G17675 102 / 1e-28 Cupredoxin superfamily protein (.1)
Potri.003G117900 103 / 1e-28 AT3G17675 108 / 6e-31 Cupredoxin superfamily protein (.1)
Potri.019G037800 90 / 3e-23 AT3G17675 98 / 4e-27 Cupredoxin superfamily protein (.1)
Potri.006G259101 89 / 1e-22 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1)
Potri.002G052500 87 / 5e-22 AT5G26330 130 / 9e-39 Cupredoxin superfamily protein (.1)
Potri.003G047300 87 / 2e-21 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1)
Potri.002G161300 85 / 4e-21 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1)
Potri.002G101300 84 / 9e-21 AT1G72230 131 / 6e-39 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10006683 pacid=23152173 polypeptide=Lus10006683 locus=Lus10006683.g ID=Lus10006683.BGIv1.0 annot-version=v1.0
ATGGCGAGGATAATGGTGGGAGTGATGATGGCAGTGGCGGCAGTTGCAGGTTTGGTCCCGGCAACTTTGGGAAAGCAGTACGTGGTCGGGGACGACAGTG
GCTGGACCGCCACCGGTGTCGATTACGAGGCTTGGGCTAAGGGCAAACACTTCGCCGTCGTTTTCAACTATCATCCAGGAAGCCACAACGTGATGATAGT
GAACGAGACGAACTACGAGGACTGCACAAGGCCTCTAACTGGCCAGCCACTCATCTCCGGTAAAGACGAGGTAAAGCTCTCGACTCCAGGCAAGAAATTT
TACATCTGCGGCGCCCCTGGCCACTGTGCAGCCGGTCAGAAGCTGGCCATCACTGTCTCCGACGTAGCTGCCTCACCCTCGACCGAGGCATCAACTCCTA
AATCCTCTGCACCAGCAATGGGAGGCATCGTTGTTACTCGCGTCGGATTCGTGGTTGTTAGCACTGTTGTTGGGATGACGGTACTGTTCCGAAAGATAAG
AATTTCGTTTTAG
AA sequence
>Lus10006683 pacid=23152173 polypeptide=Lus10006683 locus=Lus10006683.g ID=Lus10006683.BGIv1.0 annot-version=v1.0
MARIMVGVMMAVAAVAGLVPATLGKQYVVGDDSGWTATGVDYEAWAKGKHFAVVFNYHPGSHNVMIVNETNYEDCTRPLTGQPLISGKDEVKLSTPGKKF
YICGAPGHCAAGQKLAITVSDVAASPSTEASTPKSSAPAMGGIVVTRVGFVVVSTVVGMTVLFRKIRISF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G26330 Cupredoxin superfamily protein... Lus10006683 0 1
AT3G05610 Plant invertase/pectin methyle... Lus10033466 1.4 0.9659
AT4G20990 ATACA4, ACA4 A. THALIANA ALPHA CARBONIC ANH... Lus10031027 1.7 0.9793
AT1G07520 GRAS GRAS family transcription fact... Lus10037757 4.9 0.9173
Lus10006761 5.5 0.9229
AT4G31180 Class II aminoacyl-tRNA and bi... Lus10028557 5.5 0.9328
AT4G19950 unknown protein Lus10017130 5.8 0.8192
AT5G51740 Peptidase family M48 family pr... Lus10031682 6.3 0.9254
AT4G15620 Uncharacterised protein family... Lus10035168 7.7 0.8542
AT5G37360 unknown protein Lus10003097 8.0 0.8397
AT1G65820 microsomal glutathione s-trans... Lus10020792 8.9 0.9067

Lus10006683 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.