Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30220 119 / 4e-37 RUXF small nuclear ribonucleoprotein F (.1.2) AT2G14285 117 / 7e-37 Small nuclear ribonucleoprotein family protein (.1) AT3G59810 48 / 3e-09 Small nuclear ribonucleoprotein family protein (.1) AT2G43810 47 / 6e-09 Small nuclear ribonucleoprotein family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037606 [exp] 127 / 3e-40 AT4G30220 173 / 2e-58 small nuclear ribonucleoprotein F (.1.2) Lus10026860 [exp] 46 / 2e-07 AT5G36890 189 / 2e-56 beta glucosidase 42 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G092200 [exp] 120 / 5e-38 AT4G30220 155 / 2e-51 small nuclear ribonucleoprotein F (.1.2) Potri.006G167000 [exp] 91 / 3e-26 AT2G14285 62 / 1e-14 Small nuclear ribonucleoprotein family protein (.1) Potri.010G178700 [exp] 50 / 1e-09 AT2G43810 150 / 4e-49 Small nuclear ribonucleoprotein family protein (.1.2) Potri.008G078400 [exp] 49 / 1e-09 AT2G43810 166 / 2e-55 Small nuclear ribonucleoprotein family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [flax] [poplar] Sm-like PF01423 [flax] [poplar] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Lus10006867 pacid=23144385 polypeptide=Lus10006867 locus=Lus10006867.g ID=Lus10006867.BGIv1.0 annot-version=v1.0 ATGGAATATAAAGGTTTTCTTGCTTCAGTTGATTCCTACATGAACCTGCAGCTAGGGAATGCTGAAGAGTATATCGACGGGCAGTTCACTGGGAATCTGG GAGAGATCTTGATAAGGTGCAACAATGTTCTCTACATGCGAGGCGTACCAGAAGACGAGGAAATAGAAGACGCTGATCGTGATTAG
AA sequence Show only first row Show all	>Lus10006867 pacid=23144385 polypeptide=Lus10006867 locus=Lus10006867.g ID=Lus10006867.BGIv1.0 annot-version=v1.0 MEYKGFLASVDSYMNLQLGNAEEYIDGQFTGNLGEILIRCNNVLYMRGVPEDEEIEDADRD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G30220		RUXF	small nuclear ribonucleoprotei...		Lus10006867 [exp]	0	1
AT2G18400			ribosomal protein L6 family pr...		Lus10026015 [exp]	1.0	0.8953
AT3G59650			mitochondrial ribosomal protei...		Lus10006114 [exp]	2.4	0.8860
AT1G08580			unknown protein		Lus10040441 [exp]	2.8	0.8635
AT1G26880			Ribosomal protein L34e superfa...		Lus10042199 [exp]	4.5	0.8675
AT2G47580		U1A	spliceosomal protein U1A (.1)		Lus10003358 [exp]	4.6	0.8713
AT5G38890			Nucleic acid-binding, OB-fold-...		Lus10004763 [exp]	4.6	0.8651
AT3G23620			Ribosomal RNA processing Brix ...		Lus10027714 [exp]	5.7	0.8690
AT1G51510		Y14	RNA-binding (RRM/RBD/RNP motif...		Lus10003632 [exp]	8.7	0.8226
AT2G20490		NOP10, EDA27	EMBRYO SAC DEVELOPMENT ARREST ...		Lus10033907 [exp]	8.7	0.8327
AT5G20180			Ribosomal protein L36 (.1.2)		Lus10019412 [exp]	9.5	0.8034

Compare expression of checked genes

Lus10006867 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.