Lus10007025 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G26330 95 / 8e-25 Cupredoxin superfamily protein (.1)
AT2G32300 89 / 1e-21 UCC1 uclacyanin 1 (.1)
AT3G17675 84 / 2e-21 Cupredoxin superfamily protein (.1)
AT2G26720 86 / 3e-21 Cupredoxin superfamily protein (.1)
AT2G31050 86 / 3e-21 Cupredoxin superfamily protein (.1)
AT2G02850 80 / 2e-19 ARPN plantacyanin (.1)
AT5G20230 73 / 2e-16 SAG14, ATBCB SENESCENCE ASSOCIATED GENE 14, BLUE COPPER BINDING PROTEIN, blue-copper-binding protein (.1)
AT4G12880 72 / 3e-16 AtENODL19 early nodulin-like protein 19 (.1.2)
AT1G72230 71 / 1e-15 Cupredoxin superfamily protein (.1)
AT1G22480 70 / 2e-15 Cupredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006680 225 / 5e-76 AT5G26330 98 / 6e-26 Cupredoxin superfamily protein (.1)
Lus10007027 204 / 9e-68 AT5G26330 100 / 5e-27 Cupredoxin superfamily protein (.1)
Lus10006682 189 / 4e-62 AT2G32300 95 / 1e-24 uclacyanin 1 (.1)
Lus10007026 187 / 3e-61 AT2G32300 96 / 4e-25 uclacyanin 1 (.1)
Lus10007028 184 / 5e-60 AT5G26330 92 / 8e-24 Cupredoxin superfamily protein (.1)
Lus10006683 138 / 5e-42 AT5G26330 88 / 1e-22 Cupredoxin superfamily protein (.1)
Lus10006681 132 / 3e-40 AT2G32300 59 / 2e-12 uclacyanin 1 (.1)
Lus10002617 107 / 2e-28 AT3G53330 105 / 1e-26 plastocyanin-like domain-containing protein (.1)
Lus10002615 102 / 4e-28 AT5G26330 96 / 9e-26 Cupredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G061300 114 / 1e-32 AT3G17675 102 / 1e-28 Cupredoxin superfamily protein (.1)
Potri.013G030450 112 / 1e-31 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.013G030000 112 / 1e-31 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.003G117900 109 / 1e-30 AT3G17675 108 / 6e-31 Cupredoxin superfamily protein (.1)
Potri.006G259101 97 / 7e-26 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1)
Potri.006G259000 97 / 1e-25 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1)
Potri.002G161300 96 / 1e-25 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1)
Potri.008G151000 94 / 2e-24 AT5G26330 183 / 2e-59 Cupredoxin superfamily protein (.1)
Potri.010G089900 94 / 2e-24 AT5G26330 187 / 7e-61 Cupredoxin superfamily protein (.1)
Potri.002G101300 94 / 3e-24 AT1G72230 131 / 6e-39 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10007025 pacid=23168968 polypeptide=Lus10007025 locus=Lus10007025.g ID=Lus10007025.BGIv1.0 annot-version=v1.0
ATGGCCGTGTTCGCTAGCAACAAGAGGATGGCGGTCTTGATGGTTGCGGTGGTTGTTGCGCTGGCTGCTACTTTGGTCCCGATGACCTCGGCCGAGAAAT
ATGTGGTCGGGGATGGTGCTGGATGGACCAACAAGGGCGTCGATTACAAAGCTTGGGCTGAGGGCAAAACGTTCTACGTCGATGATTCCCTTGTTTTCAA
CTACGCTGCCGGAAACCACAACGTGATGAAGGTGAACGCGTCGGACTTCCTAGCGTGCACAAAGCCTCTTACCGGACCTCCTCCACTAACGTCGGGAGCT
GATGAGGTTACGCTCCTAACAACCGGAAAGAAGTGGTACATTTGCGGCGCTCCTGGCCACTGTGACGCCGGTCAAAAGCTCGTTATCACCGTTTCTGAGG
GAGCTGCGCCGGCACCAACACCCAACTCACCGCCTAACGCCGCCGTCGGTGGGATCGTTGGTATCGGATTTGCTGCCTCCATGATTGTTGGGGTTATTGG
GATGCTTTTGTTCTGA
AA sequence
>Lus10007025 pacid=23168968 polypeptide=Lus10007025 locus=Lus10007025.g ID=Lus10007025.BGIv1.0 annot-version=v1.0
MAVFASNKRMAVLMVAVVVALAATLVPMTSAEKYVVGDGAGWTNKGVDYKAWAEGKTFYVDDSLVFNYAAGNHNVMKVNASDFLACTKPLTGPPPLTSGA
DEVTLLTTGKKWYICGAPGHCDAGQKLVITVSEGAAPAPTPNSPPNAAVGGIVGIGFAASMIVGVIGMLLF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G32300 UCC1 uclacyanin 1 (.1) Lus10007025 0 1
AT5G08640 ATFLS1, FLS flavonol synthase 1 (.1.2) Lus10025619 1.7 0.9939
AT1G18790 AtRKD1, RKD1 RWP-RK domain containing 1, RW... Lus10019100 2.4 0.9939
AT1G61680 ATTPS14 terpene synthase 14 (.1.2) Lus10040632 3.0 0.9939
AT2G39040 Peroxidase superfamily protein... Lus10041250 3.7 0.9314
AT4G33550 Bifunctional inhibitor/lipid-t... Lus10005010 4.0 0.9786
AT4G21330 bHLH bHLH022, DYT1 DYSFUNCTIONAL TAPETUM 1, basic... Lus10007618 4.5 0.9636
AT1G09790 COBL6 COBRA-like protein 6 precursor... Lus10016188 4.9 0.9347
Lus10000749 6.3 0.9250
AT1G27060 Regulator of chromosome conden... Lus10012474 6.6 0.8248
AT4G14660 NRPE7 RNA polymerase Rpb7-like, N-te... Lus10024251 7.5 0.8055

Lus10007025 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.