Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62840 185 / 2e-62 Small nuclear ribonucleoprotein family protein (.1.2) AT2G47640 185 / 2e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4) AT1G21190 57 / 8e-12 Small nuclear ribonucleoprotein family protein (.1) AT1G76860 54 / 7e-11 Small nuclear ribonucleoprotein family protein (.1) AT4G20440 41 / 3e-05 SMB small nuclear ribonucleoprotein associated protein B (.1.2.3.4) AT5G44500 40 / 5e-05 Small nuclear ribonucleoprotein family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030367 [exp] 209 / 6e-72 AT2G47640 185 / 2e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4) Lus10026556 [exp] 207 / 3e-71 AT2G47640 184 / 3e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4) Lus10013840 [exp] 207 / 3e-71 AT2G47640 184 / 3e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4) Lus10011293 [exp] 49 / 9e-09 AT1G76860 175 / 8e-59 Small nuclear ribonucleoprotein family protein (.1) Lus10040487 [exp] 49 / 9e-09 AT1G76860 175 / 8e-59 Small nuclear ribonucleoprotein family protein (.1) Lus10026326 [exp] 49 / 9e-09 AT1G76860 176 / 4e-59 Small nuclear ribonucleoprotein family protein (.1) Lus10023386 [exp] 41 / 4e-05 AT5G44500 259 / 5e-87 Small nuclear ribonucleoprotein family protein (.1.2) Lus10038421 [exp] 41 / 5e-05 AT5G44500 263 / 2e-88 Small nuclear ribonucleoprotein family protein (.1.2) Lus10013108 [exp] 40 / 9e-05 AT5G44500 269 / 5e-91 Small nuclear ribonucleoprotein family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G204300 [exp] 198 / 9e-68 AT3G62840 204 / 6e-70 Small nuclear ribonucleoprotein family protein (.1.2) Potri.014G129100 [exp] 198 / 9e-68 AT3G62840 204 / 6e-70 Small nuclear ribonucleoprotein family protein (.1.2) Potri.002G068800 [exp] 52 / 4e-10 AT1G76860 175 / 1e-58 Small nuclear ribonucleoprotein family protein (.1) Potri.005G191600 [exp] 52 / 4e-10 AT1G76860 176 / 3e-59 Small nuclear ribonucleoprotein family protein (.1) Potri.014G045700 [exp] 49 / 4e-09 AT3G62840 54 / 5e-11 Small nuclear ribonucleoprotein family protein (.1.2) Potri.011G155700 [exp] 42 / 2e-05 AT4G20440 218 / 2e-70 small nuclear ribonucleoprotein associated protein B (.1.2.3.4) Potri.001G440100 [exp] 41 / 3e-05 AT4G20440 211 / 2e-67 small nuclear ribonucleoprotein associated protein B (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [flax] [poplar] Sm-like PF01423 [flax] [poplar] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Lus10007876 pacid=23143214 polypeptide=Lus10007876 locus=Lus10007876.g ID=Lus10007876.BGIv1.0 annot-version=v1.0 ATGGAAGAGGATGCTCCAAATAAGGAGGATGAGTTCAGCACCGGTCCACTTTCAGTCCTAATGATGAGTGTGAAGAACAACACCCAGGTACTGATAAACT GCCGCAACAACAAAAAGCTTCTCGGGCGTGTTAGGGCATTTGACCGCCACTGCAACATGGTGCTGGAAAATGTTAAGGAGATCTGGACCGAGGTGCCAAA GACGGGGAAAGGCAAGAAGAAGGCTCAACCAGTGAACAAAGACAGGTTCATCAGTAAAATGTTTCTCCGTGGCGATTCAGTAATCCTTGTGCTTCGGAAC CCCAAGTGA
AA sequence Show only first row Show all	>Lus10007876 pacid=23143214 polypeptide=Lus10007876 locus=Lus10007876.g ID=Lus10007876.BGIv1.0 annot-version=v1.0 MEEDAPNKEDEFSTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVKEIWTEVPKTGKGKKKAQPVNKDRFISKMFLRGDSVILVLRN PK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G47640			Small nuclear ribonucleoprotei...		Lus10007876 [exp]	0	1
AT5G27650			Tudor/PWWP/MBT superfamily pro...		Lus10043114 [exp]	1.4	0.8757
AT1G11240			unknown protein		Lus10018438 [exp]	4.2	0.8662
AT3G08880			unknown protein		Lus10012504 [exp]	5.7	0.8416
AT2G21240	BBR_BPC	BPC4, BBR/BPC4,...	basic pentacysteine 4 (.1.2)		Lus10031078 [exp]	5.7	0.8648
AT5G02530			RNA-binding (RRM/RBD/RNP motif...		Lus10040851 [exp]	7.7	0.8548
AT1G05205			unknown protein		Lus10027173 [exp]	8.1	0.8644
AT4G30220		RUXF	small nuclear ribonucleoprotei...		Lus10037606 [exp]	8.8	0.8629
AT3G15790		MBD11, ATMBD11	methyl-CPG-binding domain 11 (...		Lus10002168 [exp]	12.1	0.8616
AT2G27550		ATC	centroradialis (.1)		Lus10004884 [exp]	12.3	0.8326
AT1G26740			Ribosomal L32p protein family ...		Lus10008442 [exp]	13.4	0.8543

Compare expression of checked genes

Lus10007876 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.