Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14080 236 / 3e-82 Small nuclear ribonucleoprotein family protein (.1.2) AT1G19120 219 / 5e-75 Small nuclear ribonucleoprotein family protein (.1) AT1G65700 59 / 2e-12 Small nuclear ribonucleoprotein family protein (.1.2.3) AT3G11500 51 / 2e-09 Small nuclear ribonucleoprotein family protein (.1) AT2G23930 49 / 7e-09 SNRNP-G probable small nuclear ribonucleoprotein G (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013161 [exp] 199 / 1e-67 AT3G14080 180 / 3e-60 Small nuclear ribonucleoprotein family protein (.1.2) Lus10021342 [exp] 50 / 5e-09 AT3G11500 152 / 3e-50 Small nuclear ribonucleoprotein family protein (.1) Lus10017019 [exp] 49 / 1e-08 AT3G11500 150 / 2e-49 Small nuclear ribonucleoprotein family protein (.1) Lus10042884 [exp] 49 / 3e-08 AT1G65700 158 / 7e-52 Small nuclear ribonucleoprotein family protein (.1.2.3) Lus10028183 [exp] 42 / 1e-05 AT1G65700 155 / 8e-51 Small nuclear ribonucleoprotein family protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G068400 [exp] 249 / 5e-87 AT3G14080 234 / 3e-81 Small nuclear ribonucleoprotein family protein (.1.2) Potri.001G166600 [exp] 246 / 6e-86 AT3G14080 233 / 9e-81 Small nuclear ribonucleoprotein family protein (.1.2) Potri.001G278000 [exp] 64 / 2e-14 AT1G65700 146 / 3e-47 Small nuclear ribonucleoprotein family protein (.1.2.3) Potri.006G211100 [exp] 51 / 2e-09 AT3G11500 153 / 2e-50 Small nuclear ribonucleoprotein family protein (.1) Potri.016G078100 [exp] 50 / 3e-09 AT3G11500 152 / 5e-50 Small nuclear ribonucleoprotein family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [flax] [poplar] Sm-like PF01423 [flax] [poplar] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Lus10008124 pacid=23169746 polypeptide=Lus10008124 locus=Lus10008124.g ID=Lus10008124.BGIv1.0 annot-version=v1.0 ATGTCTTGGGCAGGGCCGGAAGATGTCTACCTGTCTACTTCTCTCGCCAGCTACCTGGATAAAAAGCTTCTTGTGCTTCTTCGGGATGGACGGAAACTTA TGGGAATACTTCGCTCTTTCGATCAATTCGCAAATGCTGTTCTTGAGGGTGCATGTGAAAGGTTGATTGTTGGTGATCTTTACTGCGATATTCCATTAGG TCTCTACGTAATTCGGGGGGAGAATGTTGTCCTAATAGGGGAGTTGGATTTGGAAAGGGAGGAGCTTCCTCCACACATGACTCGTGTCTCGACCGCTGAA ATTAAGAGGGCACAGAAAGCAGAAAGGGAAGCTTCGGATTTGAAGGGCACTATGCGGAAGAGAATGGAGTTCCTCGATCTCGATTAG
AA sequence Show only first row Show all	>Lus10008124 pacid=23169746 polypeptide=Lus10008124 locus=Lus10008124.g ID=Lus10008124.BGIv1.0 annot-version=v1.0 MSWAGPEDVYLSTSLASYLDKKLLVLLRDGRKLMGILRSFDQFANAVLEGACERLIVGDLYCDIPLGLYVIRGENVVLIGELDLEREELPPHMTRVSTAE IKRAQKAEREASDLKGTMRKRMEFLDLD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G14080			Small nuclear ribonucleoprotei...		Lus10008124 [exp]	0	1
AT5G19950			Domain of unknown function (DU...		Lus10000162 [exp]	3.0	0.8412
AT5G47890			NADH-ubiquinone oxidoreductase...		Lus10040122 [exp]	3.5	0.8643
AT2G34160			Alba DNA/RNA-binding protein (...		Lus10043279 [exp]	3.6	0.8692
AT5G56670			Ribosomal protein S30 family p...		Lus10028808 [exp]	7.1	0.8411
AT3G23100		XRCC4	homolog of human DNA ligase iv...		Lus10022210 [exp]	8.5	0.8484
AT2G21950		SKIP6	SKP1 interacting partner 6 (.1...		Lus10030606 [exp]	8.7	0.8183
AT2G18196			Heavy metal transport/detoxifi...		Lus10010147 [exp]	9.2	0.8447
AT5G08630			DDT domain-containing protein ...		Lus10029550 [exp]	9.5	0.8271
AT4G15950		RDM2, NRPE4, NR...	RNA-DIRECTED DNA METHYLATION 2...		Lus10038766 [exp]	10.4	0.8590
AT5G06210			RNA binding (RRM/RBD/RNP motif...		Lus10013306 [exp]	12.4	0.8392

Compare expression of checked genes

Lus10008124 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.