Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G27170 62 / 5e-13 transmembrane receptors;ATP binding (.1.2) AT1G27180 54 / 4e-10 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT5G36930 50 / 4e-09 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT5G17890 46 / 1e-07 CHS3, DAR4 CHILLING SENSITIVE 3, DA1-related protein 4 (.1) AT1G17600 45 / 3e-07 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G40910 45 / 4e-07 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G12010 44 / 9e-07 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G48770 44 / 1e-06 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G44870 44 / 2e-06 TTR1, LAZ5 tolerance to Tobacco ringspot virus 1, LAZARUS 5, Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G17680 43 / 2e-06 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020533 [exp] 99 / 6e-26 AT1G27170 405 / 1e-122 transmembrane receptors;ATP binding (.1.2) Lus10020534 [exp] 97 / 3e-25 AT5G36930 414 / 1e-124 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10005373 [exp] 94 / 3e-24 AT5G36930 404 / 8e-121 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10020524 [exp] 91 / 3e-23 AT1G27170 395 / 9e-119 transmembrane receptors;ATP binding (.1.2) Lus10026961 [exp] 91 / 4e-23 AT5G36930 420 / 2e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10020537 [exp] 91 / 4e-23 AT1G27170 404 / 6e-121 transmembrane receptors;ATP binding (.1.2) Lus10042714 [exp] 90 / 5e-23 AT5G36930 411 / 3e-124 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10004115 [exp] 90 / 6e-23 AT5G27970 689 / 0.0 ARM repeat superfamily protein (.1.2) Lus10020536 [exp] 89 / 2e-22 AT1G27170 392 / 8e-118 transmembrane receptors;ATP binding (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G002500 [exp] 61 / 7e-13 AT5G17680 587 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.012G053200 [exp] 58 / 8e-12 AT1G27170 1187 / 0.0 transmembrane receptors;ATP binding (.1.2) Potri.019G001602 [exp] 56 / 6e-11 AT5G36930 778 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.001G307300 [exp] 56 / 8e-11 AT5G17680 597 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.003G084333 [exp] 55 / 1e-10 AT5G36930 347 / 2e-108 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.001G028750 [exp] 54 / 2e-10 AT5G36930 516 / 3e-163 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.013G097300 [exp] 54 / 2e-10 AT5G17680 598 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.T011750 [exp] 54 / 3e-10 AT5G36930 551 / 2e-176 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.017G104301 [exp] 54 / 3e-10 AT5G17680 566 / 1e-178 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.001G066500 [exp] 52 / 1e-09 AT5G36930 462 / 2e-146 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00931 [flax] [poplar] NB-ARC NB-ARC domain
Representative CDS sequence Show only first row Show all	>Lus10008414 pacid=23163507 polypeptide=Lus10008414 locus=Lus10008414.g ID=Lus10008414.BGIv1.0 annot-version=v1.0 ATGGGAGGCCTTGGCAAAACTACTTTAGCAAAGGCTGTTTACGACAAAGTATCTACACAATTCTATCGTTGCTGTTTTTTGCCAGACGTGAGAGAAACGA TGTCGAAAAATGATGGGATGGTTACTCTACAGAATAAGATAATCTCAAACATTCTAAGGAACAAATCTGATGCAGAAAATGCCAGTGATGGAATGTGA
AA sequence Show only first row Show all	>Lus10008414 pacid=23163507 polypeptide=Lus10008414 locus=Lus10008414.g ID=Lus10008414.BGIv1.0 annot-version=v1.0 MGGLGKTTLAKAVYDKVSTQFYRCCFLPDVRETMSKNDGMVTLQNKIISNILRNKSDAENASDGM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G27170			transmembrane receptors;ATP bi...		Lus10008414 [exp]	0	1
AT1G26560		BGLU40	beta glucosidase 40 (.1)		Lus10037099 [exp]	1.4	0.9043
AT2G23180		CYP96A1	"cytochrome P450, family 96, s...		Lus10003756 [exp]	2.4	0.8612
AT2G24190		SDR2	short-chain dehydrogenase/redu...		Lus10008413 [exp]	9.2	0.7655
					Lus10039965 [exp]	13.9	0.8532
AT3G26300		CYP71B34	"cytochrome P450, family 71, s...		Lus10017677 [exp]	15.0	0.7914
AT5G39130			RmlC-like cupins superfamily p...		Lus10003267 [exp]	20.4	0.7693
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Lus10020358 [exp]	21.9	0.5511
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Lus10005144 [exp]	22.0	0.7668
AT3G50150			Plant protein of unknown funct...		Lus10005799 [exp]	23.8	0.7668
AT1G21430		YUC11	Flavin-binding monooxygenase f...		Lus10000677 [exp]	25.5	0.7668

Compare expression of checked genes

Lus10008414 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.