Lus10008720 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G72230 124 / 7e-36 Cupredoxin superfamily protein (.1)
AT1G22480 111 / 3e-31 Cupredoxin superfamily protein (.1)
AT2G32300 103 / 4e-27 UCC1 uclacyanin 1 (.1)
AT5G07475 99 / 8e-26 Cupredoxin superfamily protein (.1)
AT3G60270 96 / 6e-25 Cupredoxin superfamily protein (.1)
AT3G27200 95 / 1e-24 Cupredoxin superfamily protein (.1)
AT2G26720 91 / 7e-23 Cupredoxin superfamily protein (.1)
AT2G44790 91 / 1e-22 UCC2 uclacyanin 2 (.1)
AT2G31050 90 / 2e-22 Cupredoxin superfamily protein (.1)
AT5G26330 89 / 2e-22 Cupredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020944 233 / 9e-79 AT1G72230 141 / 1e-42 Cupredoxin superfamily protein (.1)
Lus10027043 115 / 2e-32 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1)
Lus10025580 112 / 5e-31 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1)
Lus10012085 100 / 1e-26 AT5G07475 142 / 4e-43 Cupredoxin superfamily protein (.1)
Lus10007027 97 / 1e-25 AT5G26330 100 / 5e-27 Cupredoxin superfamily protein (.1)
Lus10006682 96 / 4e-25 AT2G32300 95 / 1e-24 uclacyanin 1 (.1)
Lus10006657 100 / 5e-25 AT1G45063 106 / 1e-26 copper ion binding;electron carriers (.1.2)
Lus10038098 99 / 1e-24 AT1G45063 107 / 1e-27 copper ion binding;electron carriers (.1.2)
Lus10027143 96 / 1e-24 AT2G32300 137 / 9e-40 uclacyanin 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G101300 155 / 4e-48 AT1G72230 131 / 6e-39 Cupredoxin superfamily protein (.1)
Potri.002G101200 154 / 5e-47 AT1G72230 129 / 2e-37 Cupredoxin superfamily protein (.1)
Potri.013G061300 107 / 7e-30 AT3G17675 102 / 1e-28 Cupredoxin superfamily protein (.1)
Potri.003G150300 102 / 1e-27 AT5G07475 178 / 2e-57 Cupredoxin superfamily protein (.1)
Potri.013G030000 102 / 1e-27 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.013G030450 102 / 1e-27 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.014G049600 102 / 3e-27 AT3G60270 111 / 8e-31 Cupredoxin superfamily protein (.1)
Potri.001G332200 100 / 9e-27 AT3G27200 171 / 5e-55 Cupredoxin superfamily protein (.1)
Potri.003G117900 98 / 8e-26 AT3G17675 108 / 6e-31 Cupredoxin superfamily protein (.1)
Potri.001G080700 98 / 8e-26 AT5G07475 164 / 1e-51 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10008720 pacid=23161993 polypeptide=Lus10008720 locus=Lus10008720.g ID=Lus10008720.BGIv1.0 annot-version=v1.0
ATGGCAACCTCTGCCTCGTACGTTATTTTCTGCCTAGTTATGCTGGTTGTGCCTACCACTCTCGCCACCACTTACACCGTCGGCGACACCAGCGGCTGGG
TAATTGGCTCGGACTACTCCACTTGGACCTCCGGCAAGACCTTCAAAGTCGGCGACAGCCTCGTGTTCAACTACGCGGGAGGGCACACGGTGGACGAGGT
GAGCGGGAGCGACTACAACACGTGTACTGTGGGGAAAACAATCAGCTCCGACAACAGCGGATCCACCACCGTCACTCTCAATACCGCCGGCACCCATTAC
TTCATCTGCGGTGTGGCCGGCCACTGCAGCGGCGGTATGAAGCTCTCCGTCACAGTTGCGGCTGCAGGGTCCACCGCTCCCCCCACTACATCCACTACTT
CCCCTGCATCTCCATCGTCCGGCGGCACTTCTACCGGAACTGCTACTCCGACAACCAACCGTCCGGCGTCCAATATGCCGGATTCTTCTTCCCTTGCCAC
TGTTTCTCCGTCGATGGGAGCTGTTGTGGCTGCCGTTTTTGCAGCTGTTGCGGTCATGGTTTCGTCATCGTGA
AA sequence
>Lus10008720 pacid=23161993 polypeptide=Lus10008720 locus=Lus10008720.g ID=Lus10008720.BGIv1.0 annot-version=v1.0
MATSASYVIFCLVMLVVPTTLATTYTVGDTSGWVIGSDYSTWTSGKTFKVGDSLVFNYAGGHTVDEVSGSDYNTCTVGKTISSDNSGSTTVTLNTAGTHY
FICGVAGHCSGGMKLSVTVAAAGSTAPPTTSTTSPASPSSGGTSTGTATPTTNRPASNMPDSSSLATVSPSMGAVVAAVFAAVAVMVSSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G72230 Cupredoxin superfamily protein... Lus10008720 0 1
AT1G72230 Cupredoxin superfamily protein... Lus10020944 1.4 0.9112
AT2G38080 ATLMCO4, IRX12,... LACCASE 4, IRREGULAR XYLEM 12,... Lus10040697 1.7 0.9345
AT2G28760 UXS6 UDP-XYL synthase 6 (.1.2.3) Lus10005155 6.6 0.8839
AT5G40630 Ubiquitin-like superfamily pro... Lus10032107 7.1 0.8933
AT1G71990 ATFT4, ATFUT13,... ARABIDOPSIS FUCOSYLTRANSFERASE... Lus10009440 12.5 0.8511
AT3G27200 Cupredoxin superfamily protein... Lus10041570 23.6 0.8813
AT1G52330 Late embryogenesis abundant (L... Lus10037534 24.5 0.8490
AT1G76180 ERD14 EARLY RESPONSE TO DEHYDRATION ... Lus10021240 24.7 0.8327
AT1G08560 KN, ATSYP111, S... KNOLLE, syntaxin of plants 11... Lus10042314 25.9 0.8785
AT2G40370 LAC5 laccase 5 (.1) Lus10017426 31.0 0.8673

Lus10008720 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.