Lus10009079 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G15780 144 / 5e-43 Cupredoxin superfamily protein (.1)
AT2G15770 109 / 4e-29 Cupredoxin superfamily protein (.1)
AT4G33930 85 / 8e-20 Cupredoxin superfamily protein (.1)
AT4G34300 77 / 5e-17 Cupredoxin superfamily protein (.1)
AT3G27200 47 / 8e-07 Cupredoxin superfamily protein (.1)
AT4G32490 40 / 0.0003 AtENODL4 early nodulin-like protein 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025269 300 / 9e-106 AT2G15780 141 / 4e-42 Cupredoxin superfamily protein (.1)
Lus10002618 48 / 2e-07 AT3G27200 89 / 2e-23 Cupredoxin superfamily protein (.1)
Lus10022350 47 / 1e-06 AT3G27200 169 / 7e-54 Cupredoxin superfamily protein (.1)
Lus10041570 44 / 1e-05 AT3G27200 167 / 2e-53 Cupredoxin superfamily protein (.1)
Lus10020276 43 / 8e-05 AT1G45063 116 / 9e-30 copper ion binding;electron carriers (.1.2)
Lus10025536 41 / 0.0001 AT2G27035 148 / 5e-46 early nodulin-like protein 20 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G106000 170 / 2e-54 AT2G15780 151 / 5e-46 Cupredoxin superfamily protein (.1)
Potri.009G136200 44 / 1e-05 AT5G26330 88 / 4e-22 Cupredoxin superfamily protein (.1)
Potri.001G332200 43 / 3e-05 AT3G27200 171 / 5e-55 Cupredoxin superfamily protein (.1)
Potri.013G054500 43 / 3e-05 AT3G17675 91 / 3e-24 Cupredoxin superfamily protein (.1)
Potri.017G011200 43 / 3e-05 AT4G32490 157 / 2e-48 early nodulin-like protein 4 (.1)
Potri.019G037800 42 / 5e-05 AT3G17675 98 / 4e-27 Cupredoxin superfamily protein (.1)
Potri.002G161300 40 / 0.0004 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1)
Potri.003G183300 40 / 0.0004 AT5G15350 123 / 1e-35 early nodulin-like protein 17 (.1)
Potri.001G043600 39 / 0.0006 AT5G15350 121 / 2e-35 early nodulin-like protein 17 (.1)
Potri.013G030000 39 / 0.0006 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10009079 pacid=23172402 polypeptide=Lus10009079 locus=Lus10009079.g ID=Lus10009079.BGIv1.0 annot-version=v1.0
ATGGCACTACTATACGCAAAAGCAACTGCTATGTTCGTGATCATGTTGAGCTCCGCCGCATTGGGTATCACGTCGGCCAACAAAGACTGGGGTAACGGAA
ACTACGGCGGCGGTTGGGGCCCCCGCGGTAACCCGCCGACGAACCGGCGGCCCAGCGAGCACACTCCGAGGAAGATAGTGGTGGGCGGGAAACAGACTTG
GGAGTTCGGCTTTGACTATACTAACTGGGCCATGCGTAATGGGCCTTTCTTCGTCAACGACACTTTAGTGTTTAAATACAAGATGCCGGTGGACAACAGT
ACCAGACCACACAGCGTGTACCAGCTGCCAGACTTGAGGAGCTTCCTGAAGTGCGACGTCAGCAAGGGAAAGATGTTGGCCAACTGGACTGACGGCGGTG
GCAAAGGGTTCGAGTTCACTATGGAGAAGTGGCAGCCTTACTTCTTCGCATGTGGGTCTGGCAATGGAATCCATTGCAACCTTGGCCGGATGAAGTTCTT
CGTCGTCCCCCTCCTCCCTCGCTGGTGGAATTACTGA
AA sequence
>Lus10009079 pacid=23172402 polypeptide=Lus10009079 locus=Lus10009079.g ID=Lus10009079.BGIv1.0 annot-version=v1.0
MALLYAKATAMFVIMLSSAALGITSANKDWGNGNYGGGWGPRGNPPTNRRPSEHTPRKIVVGGKQTWEFGFDYTNWAMRNGPFFVNDTLVFKYKMPVDNS
TRPHSVYQLPDLRSFLKCDVSKGKMLANWTDGGGKGFEFTMEKWQPYFFACGSGNGIHCNLGRMKFFVVPLLPRWWNY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G15780 Cupredoxin superfamily protein... Lus10009079 0 1
AT2G05920 Subtilase family protein (.1) Lus10006689 19.7 0.8242
AT5G12340 unknown protein Lus10009698 40.2 0.8056
AT5G19890 Peroxidase superfamily protein... Lus10026748 57.1 0.8008
AT3G25160 ER lumen protein retaining rec... Lus10038198 77.9 0.7580
AT3G02990 HSF ATHSFA1E heat shock transcription facto... Lus10005925 79.2 0.7898
Lus10041745 94.2 0.7905
AT1G68630 PLAC8 family protein (.1) Lus10009036 113.3 0.7478
AT3G26880 Plant self-incompatibility pro... Lus10038164 118.0 0.7486
AT1G02360 Chitinase family protein (.1) Lus10009968 140.0 0.7438
Lus10002237 145.9 0.7275

Lus10009079 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.