Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G22810 132 / 1e-40 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G71520 126 / 3e-38 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G67190 97 / 3e-26 AP2_ERF DEAR2 DREB and EAR motif protein 2 (.1) AT3G50260 95 / 8e-26 AP2_ERF DEAR1, CEJ1, ATERF#011 DREB AND EAR MOTIF PROTEIN 1, cooperatively regulated by ethylene and jasmonate 1 (.1) AT1G74930 93 / 1e-24 AP2_ERF ORA47, ERF018 Integrase-type DNA-binding superfamily protein (.1) AT4G06746 91 / 3e-24 AP2_ERF DEAR5, RAP2.9 DREB AND EAR MOTIF PROTEIN 5, related to AP2 9 (.1) AT4G36900 91 / 7e-24 AP2_ERF DEAR4, RAP2.10 DREB AND EAR MOTIF PROTEIN 4, related to AP2 10 (.1) AT1G19210 89 / 3e-23 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G21910 88 / 4e-22 AP2_ERF DREB26 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1) AT2G23340 86 / 6e-22 AP2_ERF DEAR3 DREB and EAR motif protein 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041044 [exp] 150 / 2e-47 AT1G71520 138 / 9e-43 Integrase-type DNA-binding superfamily protein (.1) Lus10006179 [exp] 125 / 1e-37 AT1G71520 123 / 7e-37 Integrase-type DNA-binding superfamily protein (.1) Lus10038082 [exp] 88 / 3e-22 AT5G21960 155 / 3e-47 Integrase-type DNA-binding superfamily protein (.1) Lus10009798 [exp] 85 / 9e-22 AT1G19210 132 / 1e-39 Integrase-type DNA-binding superfamily protein (.1) Lus10009373 [exp] 85 / 1e-21 AT5G67190 164 / 3e-52 DREB and EAR motif protein 2 (.1) Lus10033420 [exp] 86 / 2e-21 AT1G19210 181 / 4e-58 Integrase-type DNA-binding superfamily protein (.1) Lus10010043 [exp] 84 / 2e-21 AT2G23340 170 / 1e-54 DREB and EAR motif protein 3 (.1) Lus10018727 [exp] 84 / 5e-21 AT5G67190 162 / 1e-51 DREB and EAR motif protein 2 (.1) Lus10007799 [exp] 82 / 5e-21 AT2G44940 136 / 7e-42 Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G073300 [exp] 150 / 4e-47 AT1G22810 144 / 1e-44 Integrase-type DNA-binding superfamily protein (.1) Potri.013G100300 [exp] 147 / 5e-46 AT1G22810 140 / 5e-43 Integrase-type DNA-binding superfamily protein (.1) Potri.007G046500 [exp] 92 / 4e-24 AT5G67190 149 / 7e-46 DREB and EAR motif protein 2 (.1) Potri.006G138700 [exp] 90 / 2e-23 AT1G19210 174 / 1e-55 Integrase-type DNA-binding superfamily protein (.1) Potri.005G140900 [exp] 88 / 8e-23 AT5G67190 169 / 1e-53 DREB and EAR motif protein 2 (.1) Potri.006G218200 [exp] 89 / 9e-23 AT1G19210 176 / 4e-56 Integrase-type DNA-binding superfamily protein (.1) Potri.005G176000 [exp] 89 / 1e-22 AT1G21910 140 / 3e-41 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1) Potri.006G138800 [exp] 88 / 1e-22 AT1G19210 189 / 3e-61 Integrase-type DNA-binding superfamily protein (.1) Potri.014G025200 [exp] 86 / 3e-22 AT1G46768 160 / 3e-51 related to AP2 1 (.1) Potri.018G038100 [exp] 86 / 5e-22 AT5G21960 100 / 5e-27 Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10009468 pacid=23149710 polypeptide=Lus10009468 locus=Lus10009468.g ID=Lus10009468.BGIv1.0 annot-version=v1.0 ATGAACCATCCCGCCGTCGCCGACGTCGACAGCGACAGAAAGTACAAGGGAGTCCGCCGGAGGAAATGGGGGAAGTGGGTGTCGGAGATCCGGGTCCCGG GCACCCAGGAGCGCCTCTGGCTGGGCTCTTACTCTTCCCCCGAAGCCGCAGCTTTCGCCCACGACGTCGCCTCCTTTTGCCTGAAAGGCAACTCATCGTC GCCGTCTAATTTCCCGATGACGGCTTTGCCGGCGCTCCGGCAGGACATGTCGCCGAAGTCTGTTCAGAGGGCGGCGTCGGAAGCCGGGGTGGCGGTGGAT GCGCAGATGATATTGCGGAATTCGCAGAACGGCGCTGGATCGGGGTCTACCGGAAGGGAGCTTAATGTGTCTGTAGAAGATTATATGTGA
AA sequence Show only first row Show all	>Lus10009468 pacid=23149710 polypeptide=Lus10009468 locus=Lus10009468.g ID=Lus10009468.BGIv1.0 annot-version=v1.0 MNHPAVADVDSDRKYKGVRRRKWGKWVSEIRVPGTQERLWLGSYSSPEAAAFAHDVASFCLKGNSSSPSNFPMTALPALRQDMSPKSVQRAASEAGVAVD AQMILRNSQNGAGSGSTGRELNVSVEDYM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G22810	AP2_ERF		Integrase-type DNA-binding sup...		Lus10009468 [exp]	0	1
AT3G58880			F-box/RNI-like superfamily pro...		Lus10035669 [exp]	2.0	0.9521
AT1G14550			Peroxidase superfamily protein...		Lus10024205 [exp]	5.1	0.9607
AT1G14205			Ribosomal L18p/L5e family prot...		Lus10012820 [exp]	5.7	0.9558
AT5G28540		BIP1	heat shock protein 70 (Hsp 70)...		Lus10019915 [exp]	7.7	0.9465
AT1G14550			Peroxidase superfamily protein...		Lus10024209 [exp]	8.8	0.9590
AT1G13090		CYP71B28	"cytochrome P450, family 71, s...		Lus10002670 [exp]	9.8	0.9389
AT1G47710			Serine protease inhibitor (SER...		Lus10019009 [exp]	10.1	0.9312
AT2G29070			Ubiquitin fusion degradation U...		Lus10029298 [exp]	12.8	0.9382
AT1G55230			Family of unknown function (DU...		Lus10039191 [exp]	14.2	0.9199
AT1G03495			HXXXD-type acyl-transferase fa...		Lus10020714 [exp]	17.0	0.9455

Compare expression of checked genes

Lus10009468 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.