Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G15360 203 / 4e-67 AP2_ERF WIN1, SHN1 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) AT5G25390 182 / 6e-59 AP2_ERF SHN3, SHN2 shine3, Integrase-type DNA-binding superfamily protein (.1.2) AT5G11190 159 / 7e-50 AP2_ERF SHN2, SHN3 shine2, Integrase-type DNA-binding superfamily protein (.1) AT5G25190 109 / 1e-30 AP2_ERF ESE3 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) AT2G47520 85 / 3e-21 AP2_ERF AtERF71, ERF71, HRE2 HYPOXIA RESPONSIVE ERF \(ETHYLENE RESPONSE FACTOR\) 2, Arabidopsis thaliana ethylene response factor 71, Integrase-type DNA-binding superfamily protein (.1) AT4G11140 87 / 5e-21 AP2_ERF CRF1 cytokinin response factor 1 (.1) AT1G36060 87 / 1e-20 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G53290 87 / 1e-20 AP2_ERF CRF3 cytokinin response factor 3 (.1) AT2G22200 85 / 2e-20 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G03800 85 / 2e-20 AP2_ERF AtERF10 ARABIDOPSIS THALIANA RF DOMAIN PROTEIN 10, ERF domain protein 10 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003506 [exp] 207 / 6e-70 AT1G15360 105 / 3e-29 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10030097 [exp] 207 / 3e-68 AT1G15360 234 / 1e-78 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10005716 [exp] 206 / 5e-68 AT1G15360 236 / 3e-79 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10019414 [exp] 190 / 2e-61 AT1G15360 207 / 1e-67 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10043271 [exp] 144 / 2e-43 AT1G15360 160 / 2e-49 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10002015 [exp] 142 / 5e-43 AT1G15360 183 / 4e-59 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10002912 [exp] 136 / 5e-41 AT5G25390 187 / 6e-61 shine3, Integrase-type DNA-binding superfamily protein (.1.2) Lus10041023 [exp] 117 / 3e-33 AT5G25190 205 / 7e-68 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10035859 [exp] 106 / 3e-29 AT5G25190 196 / 9e-65 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G033000 [exp] 206 / 2e-68 AT1G15360 181 / 3e-58 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.018G131400 [exp] 192 / 8e-63 AT1G15360 194 / 6e-63 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.018G028000 [exp] 184 / 5e-60 AT5G11190 204 / 8e-68 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.006G069400 [exp] 183 / 4e-59 AT1G15360 186 / 9e-60 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.006G253800 [exp] 176 / 2e-56 AT5G11190 197 / 1e-64 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.018G021900 [exp] 109 / 2e-30 AT5G25190 169 / 1e-53 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.006G261200 [exp] 109 / 2e-30 AT5G25190 169 / 9e-54 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.001G048200 [exp] 108 / 6e-30 AT5G25190 162 / 5e-51 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.013G158500 [exp] 89 / 3e-21 AT4G27950 124 / 1e-32 cytokinin response factor 4 (.1) Potri.019G131300 [exp] 87 / 8e-21 AT4G27950 139 / 2e-38 cytokinin response factor 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10009480 pacid=23149746 polypeptide=Lus10009480 locus=Lus10009480.g ID=Lus10009480.BGIv1.0 annot-version=v1.0 ATGGTGCAACCAAGGAAGTTCAGAGGAGTCCGCCAACGCCATTGGGGTTCATGGGTCTCCGAGATTCGTCATCCATTGCTGAAGAGAAGAGTATGGCTTG GCACGTTCGAGACTGCGGAGGAGGCAGCTCGAGCTTACGACGAAGCATCCATCCTCATGAGCGGCCGCAACGCCAAAACTAACTTTCCCGCCACTGCGTA TCTTCACCGGAACACTTCTTTAACTCCGGCCACAGCAACTCTGAGTGCTAAGCTAAGAAAATCCTGCTGCAAAATGACGCCGTCTCCTTCCTTAACTTGC TTGCGCCTGGACAACGAGAGCTCCCACATTGGTGTGTGGCAGAAGCGGGCCGGGTCTCAGTCGAATTCGAAATGGGTCATGACGGTTGAGCTCAAGAAAA CCAAGCCAGCCTGCGAAAAGGGAGCTCTCGTTGATGGATCGTCAGAGGCTGTGGAAGGTCGGGATGAAGAGGAGGAAATGATTGCATTGCAAATGATAGA TGAACTTCTTTACAATAGAAGTTAG
AA sequence Show only first row Show all	>Lus10009480 pacid=23149746 polypeptide=Lus10009480 locus=Lus10009480.g ID=Lus10009480.BGIv1.0 annot-version=v1.0 MVQPRKFRGVRQRHWGSWVSEIRHPLLKRRVWLGTFETAEEAARAYDEASILMSGRNAKTNFPATAYLHRNTSLTPATATLSAKLRKSCCKMTPSPSLTC LRLDNESSHIGVWQKRAGSQSNSKWVMTVELKKTKPACEKGALVDGSSEAVEGRDEEEEMIALQMIDELLYNRS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G15360	AP2_ERF	WIN1, SHN1	WAX INDUCER 1, SHINE 1, Integr...		Lus10009480 [exp]	0	1
AT2G31730	bHLH		basic helix-loop-helix (bHLH) ...		Lus10041649 [exp]	1.7	0.9489
AT3G23770			O-Glycosyl hydrolases family 1...		Lus10023226 [exp]	3.2	0.9366
					Lus10004778 [exp]	4.9	0.9329
AT3G54070			Ankyrin repeat family protein ...		Lus10038357 [exp]	5.7	0.9255
AT4G12310		CYP706A5	"cytochrome P450, family 706, ...		Lus10024580 [exp]	5.9	0.9205
AT1G79400		ATCHX2	cation/H+ exchanger 2, cation/...		Lus10026156 [exp]	6.2	0.9043
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Lus10023850 [exp]	7.1	0.9250
AT1G55200			Protein kinase protein with ad...		Lus10041608 [exp]	8.1	0.9109
AT3G48560		TZP5, IMR1, ALS...	TRIAZOLOPYRIMIDINE RESISTANT 5...		Lus10032037 [exp]	8.4	0.9137
AT1G77410		BGAL16	beta-galactosidase 16 (.1)		Lus10018138 [exp]	10.1	0.9248

Compare expression of checked genes

Lus10009480 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.