Lus10009617 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G18590 145 / 2e-44 AtENODL5 early nodulin-like protein 5 (.1)
AT1G48940 143 / 1e-43 AtENODL6 early nodulin-like protein 6 (.1)
AT5G14345 109 / 7e-31 AtENODL21 early nodulin-like protein 21 (.1)
AT1G79800 102 / 2e-27 AtENODL7 early nodulin-like protein 7 (.1)
AT4G31840 101 / 4e-27 AtENODL15 early nodulin-like protein 15 (.1)
AT4G28365 99 / 5e-26 AtENODL3 early nodulin-like protein 3 (.1)
AT2G25060 97 / 1e-25 AtENODL14 early nodulin-like protein 14 (.1)
AT4G32490 98 / 3e-25 AtENODL4 early nodulin-like protein 4 (.1)
AT5G57920 92 / 1e-23 AtENODL10 early nodulin-like protein 10 (.1)
AT4G30590 88 / 7e-22 AtENODL12 early nodulin-like protein 12 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022318 127 / 5e-37 AT3G18590 146 / 4e-45 early nodulin-like protein 5 (.1)
Lus10032111 122 / 2e-35 AT5G14345 147 / 1e-45 early nodulin-like protein 21 (.1)
Lus10014880 121 / 1e-34 AT3G18590 144 / 1e-43 early nodulin-like protein 5 (.1)
Lus10026880 96 / 1e-24 AT5G25090 167 / 8e-53 early nodulin-like protein 13 (.1)
Lus10003432 94 / 8e-24 AT5G25090 167 / 5e-53 early nodulin-like protein 13 (.1)
Lus10022522 88 / 7e-22 AT3G18590 95 / 2e-24 early nodulin-like protein 5 (.1)
Lus10039852 88 / 8e-22 AT4G28365 150 / 8e-46 early nodulin-like protein 3 (.1)
Lus10018617 87 / 4e-21 AT4G28365 150 / 5e-46 early nodulin-like protein 3 (.1)
Lus10037575 85 / 2e-20 AT1G79800 127 / 4e-37 early nodulin-like protein 7 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G052000 149 / 5e-46 AT1G48940 163 / 1e-51 early nodulin-like protein 6 (.1)
Potri.001G338800 137 / 2e-41 AT5G14345 145 / 6e-45 early nodulin-like protein 21 (.1)
Potri.006G264600 100 / 1e-26 AT2G25060 184 / 9e-60 early nodulin-like protein 14 (.1)
Potri.006G184100 99 / 4e-26 AT4G31840 174 / 5e-56 early nodulin-like protein 15 (.1)
Potri.017G011200 99 / 8e-26 AT4G32490 157 / 2e-48 early nodulin-like protein 4 (.1)
Potri.001G187700 97 / 1e-25 AT1G79800 176 / 2e-56 early nodulin-like protein 7 (.1)
Potri.018G018200 97 / 2e-25 AT2G25060 177 / 7e-57 early nodulin-like protein 14 (.1)
Potri.015G113300 90 / 5e-23 AT5G14345 110 / 9e-32 early nodulin-like protein 21 (.1)
Potri.003G050500 86 / 5e-21 AT1G79800 162 / 1e-50 early nodulin-like protein 7 (.1)
Potri.011G135400 86 / 8e-21 AT3G20570 138 / 4e-41 early nodulin-like protein 9 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10009617 pacid=23140047 polypeptide=Lus10009617 locus=Lus10009617.g ID=Lus10009617.BGIv1.0 annot-version=v1.0
ATGCCGAAGATGATTAACAAACATAATATGATCCTACCAGCAAGTTTGATGATCATCCTCCTCTGTTTTTTCACCACCGGAGTAACCTCCAAGGAGCTGA
TCGTCGGCGGGGAAGAAGGGTGGGCAGTTCCCAAGTCGAAAGACGAGCAGCAACGCCTCTTCTTCTTCAACGACTGGGCTTCCTCCAACCGATTCCAACT
CAACGACACTCTCAGGTTCAAGTACCAGAAGGACTCGGTGATGGTGGTGGCGGAGGAAGAGGAATACAACAAGTGCAGGAGCTCGCACCCTGTCGTCTAC
TTCAACGACGGTGACACTTCGTTTGCGTTGGATCGGCCTGGATTGTTCTACTTCATTAGTGGCGTCACTGGACATTGTGAACGTGGGTTGAAGATGACTG
TTAAGGTGCTTGACGTGGATAATTACGCCGGTGACGGTGATGCTCCGAGTGGTCAGCCGGACGATGGTCGTGAAGAGAAGTCGTCGGCAGGGGCGTCCTC
TGCTGAGTACTCTGCTGCCTCCATTGCTGCTGCTGCTCTGCTTGCATTGTCTTTGTTGTTTTGA
AA sequence
>Lus10009617 pacid=23140047 polypeptide=Lus10009617 locus=Lus10009617.g ID=Lus10009617.BGIv1.0 annot-version=v1.0
MPKMINKHNMILPASLMIILLCFFTTGVTSKELIVGGEEGWAVPKSKDEQQRLFFFNDWASSNRFQLNDTLRFKYQKDSVMVVAEEEEYNKCRSSHPVVY
FNDGDTSFALDRPGLFYFISGVTGHCERGLKMTVKVLDVDNYAGDGDAPSGQPDDGREEKSSAGASSAEYSAASIAAAALLALSLLF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G18590 AtENODL5 early nodulin-like protein 5 (... Lus10009617 0 1
AT5G55050 GDSL-like Lipase/Acylhydrolase... Lus10025104 1.0 0.9877
AT2G47140 AtSDR5 short-chain dehydrogenase redu... Lus10022760 3.5 0.9272
AT5G10380 ATRING1, RING1 RING/U-box superfamily protein... Lus10029456 12.9 0.7391
Lus10034328 13.0 0.9348
AT5G19580 glyoxal oxidase-related protei... Lus10012979 15.6 0.8177
AT5G40960 Protein of unknown function (D... Lus10032031 17.8 0.8460
AT1G34580 Major facilitator superfamily ... Lus10020934 17.9 0.7430
Lus10009393 19.7 0.9153
AT4G15550 IAGLU indole-3-acetate beta-D-glucos... Lus10027584 21.7 0.8916
AT2G39510 nodulin MtN21 /EamA-like trans... Lus10040310 22.2 0.9127

Lus10009617 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.