Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G19210 133 / 7e-40 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G74930 127 / 3e-37 AP2_ERF ORA47, ERF018 Integrase-type DNA-binding superfamily protein (.1) AT5G21960 126 / 5e-37 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G31060 99 / 1e-26 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G36900 96 / 3e-25 AP2_ERF DEAR4, RAP2.10 DREB AND EAR MOTIF PROTEIN 4, related to AP2 10 (.1) AT2G23340 95 / 4e-25 AP2_ERF DEAR3 DREB and EAR motif protein 3 (.1) AT5G67190 95 / 5e-25 AP2_ERF DEAR2 DREB and EAR motif protein 2 (.1) AT3G50260 93 / 1e-24 AP2_ERF DEAR1, CEJ1, ATERF#011 DREB AND EAR MOTIF PROTEIN 1, cooperatively regulated by ethylene and jasmonate 1 (.1) AT4G06746 92 / 4e-24 AP2_ERF DEAR5, RAP2.9 DREB AND EAR MOTIF PROTEIN 5, related to AP2 9 (.1) AT1G46768 91 / 8e-24 AP2_ERF RAP2.1 related to AP2 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033420 [exp] 131 / 7e-39 AT1G19210 181 / 4e-58 Integrase-type DNA-binding superfamily protein (.1) Lus10034885 [exp] 124 / 5e-36 AT1G19210 172 / 2e-54 Integrase-type DNA-binding superfamily protein (.1) Lus10010043 [exp] 99 / 1e-26 AT2G23340 170 / 1e-54 DREB and EAR motif protein 3 (.1) Lus10009373 [exp] 96 / 2e-25 AT5G67190 164 / 3e-52 DREB and EAR motif protein 2 (.1) Lus10018727 [exp] 93 / 2e-24 AT5G67190 162 / 1e-51 DREB and EAR motif protein 2 (.1) Lus10009468 [exp] 86 / 6e-22 AT1G22810 132 / 1e-40 Integrase-type DNA-binding superfamily protein (.1) Lus10039809 [exp] 90 / 1e-21 AT2G20880 186 / 1e-55 ERF domain 53, Integrase-type DNA-binding superfamily protein (.1) Lus10006179 [exp] 83 / 6e-21 AT1G71520 123 / 7e-37 Integrase-type DNA-binding superfamily protein (.1) Lus10033463 [exp] 87 / 8e-21 AT1G78080 248 / 2e-80 wound induced dedifferentiation 1, related to AP2 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G218200 [exp] 135 / 2e-40 AT1G19210 176 / 4e-56 Integrase-type DNA-binding superfamily protein (.1) Potri.018G047300 [exp] 133 / 8e-40 AT1G19210 169 / 1e-53 Integrase-type DNA-binding superfamily protein (.1) Potri.006G138800 [exp] 127 / 2e-37 AT1G19210 189 / 3e-61 Integrase-type DNA-binding superfamily protein (.1) Potri.006G138700 [exp] 122 / 3e-35 AT1G19210 174 / 1e-55 Integrase-type DNA-binding superfamily protein (.1) Potri.006G138900 [exp] 108 / 9e-31 AT5G21960 86 / 3e-21 Integrase-type DNA-binding superfamily protein (.1) Potri.018G038100 [exp] 105 / 2e-29 AT5G21960 100 / 5e-27 Integrase-type DNA-binding superfamily protein (.1) Potri.014G025200 [exp] 97 / 3e-26 AT1G46768 160 / 3e-51 related to AP2 1 (.1) Potri.002G124000 [exp] 97 / 3e-26 AT1G46768 158 / 3e-50 related to AP2 1 (.1) Potri.007G046500 [exp] 97 / 6e-26 AT5G67190 149 / 7e-46 DREB and EAR motif protein 2 (.1) Potri.006G080300 [exp] 96 / 2e-25 AT4G31060 143 / 1e-43 Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10009798 pacid=23159579 polypeptide=Lus10009798 locus=Lus10009798.g ID=Lus10009798.BGIv1.0 annot-version=v1.0 ATGGAGGCCGATCAGTCTAGGACTTATGGTTCTTCTTCTTCTACGTCGACTACTACTGGAATGGAGCAGGAGCAGGAGGTGAAGTACAAAGGCGTACGGA AGCGGAAATGGGGGAAGTGGGTTTCGGAGATAAGGCTACCAAACAGCCGTGAGAGGATATGGTTAGGTTCCTACGACTCCCCGGAAAAAGCTGCTCGTGC CTTCGACGCCGCTCTCTACTGCCTTCGGGGACCCGTCGCCCGCTTCAACTTCCCCGACAACCCGCCTGACATTTCATTGACGGCGCCTTGCTTACCCCTC AAGATATCCAACTCGTGGCTGCCAGGTATGCCAACCAAATCAAGAGCACACATTCTACCCAACATCATATCCCTAAACAAGACGGTCAACAACAACAACA AGACCAAACATTATTGTTTTCGGCACGTGATGGAAATGATAAAGGCAATTGCTCGAATACGACATCCGCAGCAGATGAGAATGTAA
AA sequence Show only first row Show all	>Lus10009798 pacid=23159579 polypeptide=Lus10009798 locus=Lus10009798.g ID=Lus10009798.BGIv1.0 annot-version=v1.0 MEADQSRTYGSSSSTSTTTGMEQEQEVKYKGVRKRKWGKWVSEIRLPNSRERIWLGSYDSPEKAARAFDAALYCLRGPVARFNFPDNPPDISLTAPCLPL KISNSWLPGMPTKSRAHILPNIISLNKTVNNNNKTKHYCFRHVMEMIKAIARIRHPQQMRM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G19210	AP2_ERF		Integrase-type DNA-binding sup...		Lus10009798 [exp]	0	1
AT1G80840	WRKY	ATWRKY40, WRKY4...	WRKY DNA-binding protein 40 (....		Lus10024074 [exp]	1.7	0.9563
AT5G21960	AP2_ERF		Integrase-type DNA-binding sup...		Lus10038082 [exp]	3.0	0.9285
AT2G18170		ATMPK7	MAP kinase 7 (.1)		Lus10014283 [exp]	3.2	0.9224
AT1G19210	AP2_ERF		Integrase-type DNA-binding sup...		Lus10033420 [exp]	3.5	0.9321
AT1G30135	ZIM	TIFY5A, JAZ8	jasmonate-zim-domain protein 8...		Lus10038506 [exp]	5.3	0.9121
AT1G18210			Calcium-binding EF-hand family...		Lus10018012 [exp]	6.0	0.9131
AT1G80840	WRKY	ATWRKY40, WRKY4...	WRKY DNA-binding protein 40 (....		Lus10041660 [exp]	6.6	0.9270
AT1G29690		CAD1	constitutively activated cell ...		Lus10002768 [exp]	8.9	0.8612
AT5G54165			unknown protein		Lus10023231 [exp]	8.9	0.9075
AT1G32928			unknown protein		Lus10033221 [exp]	9.2	0.8740

Compare expression of checked genes

Lus10009798 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.