Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G23340 162 / 1e-51 AP2_ERF DEAR3 DREB and EAR motif protein 3 (.1) AT3G50260 159 / 2e-50 AP2_ERF DEAR1, CEJ1, ATERF#011 DREB AND EAR MOTIF PROTEIN 1, cooperatively regulated by ethylene and jasmonate 1 (.1) AT5G67190 156 / 4e-49 AP2_ERF DEAR2 DREB and EAR motif protein 2 (.1) AT4G36900 150 / 8e-47 AP2_ERF DEAR4, RAP2.10 DREB AND EAR MOTIF PROTEIN 4, related to AP2 10 (.1) AT1G46768 145 / 2e-45 AP2_ERF RAP2.1 related to AP2 1 (.1) AT4G06746 135 / 3e-41 AP2_ERF DEAR5, RAP2.9 DREB AND EAR MOTIF PROTEIN 5, related to AP2 9 (.1) AT4G16750 107 / 5e-30 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G71450 99 / 1e-26 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G21910 100 / 2e-26 AP2_ERF DREB26 dehydration response element-binding protein 26, Integrase-type DNA-binding superfamily protein (.1) AT1G74930 97 / 1e-25 AP2_ERF ORA47, ERF018 Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018727 [exp] 174 / 2e-56 AT5G67190 162 / 1e-51 DREB and EAR motif protein 2 (.1) Lus10009373 [exp] 148 / 5e-46 AT5G67190 164 / 3e-52 DREB and EAR motif protein 2 (.1) Lus10033420 [exp] 100 / 1e-26 AT1G19210 181 / 4e-58 Integrase-type DNA-binding superfamily protein (.1) Lus10009798 [exp] 98 / 2e-26 AT1G19210 132 / 1e-39 Integrase-type DNA-binding superfamily protein (.1) Lus10038082 [exp] 99 / 3e-26 AT5G21960 155 / 3e-47 Integrase-type DNA-binding superfamily protein (.1) Lus10002801 [exp] 96 / 5e-25 AT5G11590 209 / 4e-68 TINY2, Integrase-type DNA-binding superfamily protein (.1) Lus10001601 [exp] 94 / 3e-24 AT5G11590 159 / 1e-48 TINY2, Integrase-type DNA-binding superfamily protein (.1) Lus10034885 [exp] 92 / 2e-23 AT1G19210 172 / 2e-54 Integrase-type DNA-binding superfamily protein (.1) Lus10034949 [exp] 93 / 3e-23 AT4G32800 169 / 3e-51 Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G025200 [exp] 182 / 7e-60 AT1G46768 160 / 3e-51 related to AP2 1 (.1) Potri.002G124000 [exp] 179 / 2e-58 AT1G46768 158 / 3e-50 related to AP2 1 (.1) Potri.007G046500 [exp] 149 / 3e-46 AT5G67190 149 / 7e-46 DREB and EAR motif protein 2 (.1) Potri.005G140900 [exp] 149 / 5e-46 AT5G67190 169 / 1e-53 DREB and EAR motif protein 2 (.1) Potri.018G047300 [exp] 103 / 5e-28 AT1G19210 169 / 1e-53 Integrase-type DNA-binding superfamily protein (.1) Potri.006G138900 [exp] 101 / 6e-28 AT5G21960 86 / 3e-21 Integrase-type DNA-binding superfamily protein (.1) Potri.013G101100 [exp] 100 / 7e-27 AT1G71450 184 / 1e-59 Integrase-type DNA-binding superfamily protein (.1) Potri.018G038100 [exp] 99 / 7e-27 AT5G21960 100 / 5e-27 Integrase-type DNA-binding superfamily protein (.1) Potri.014G099900 [exp] 99 / 2e-26 AT1G01250 191 / 4e-62 Integrase-type DNA-binding superfamily protein (.1) Potri.014G055700 [exp] 99 / 8e-26 AT2G44940 206 / 2e-65 Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10010043 pacid=23155639 polypeptide=Lus10010043 locus=Lus10010043.g ID=Lus10010043.BGIv1.0 annot-version=v1.0 ATGGACGTTCGGCACCGCGACTCAACCTCACCGACCATCACAAGCAGCAACACGGAGAATAAGCGTAAGCACGTCGTAGAGAAGCCGTACAGGGGAATAA GGATGAGGAAGTGGGGGAAGTGGGTGGCCGAGATTCGGGAGCCTAACAAGCGTTCAAGGATTTGGCTTGGTTCTTACTCCACCCCTGTCGCCGCCGCCAG AGCCTACGACACCGCCGTCTTCTACCTTCGTGGTCCCTCCGCCCGCCTCAACTTCCCCGACTTGATTGACCACCTCACCCCACCCGACCACGCTGTATCC GCCGCCTCCATCCGTCAGAAGGCCACCGAGATCGGCGCTCAAGTCGACGCCCTCCAAACCTCTACTACTACTACTCCAACATCTTCCTCAGGCGATCACT CCAACGTCGTCATCCCGGAAAACCCCGACTTGAACGAGTACCCCAACCCAGAAAATTCGGACAACGAACAAGAGTAG
AA sequence Show only first row Show all	>Lus10010043 pacid=23155639 polypeptide=Lus10010043 locus=Lus10010043.g ID=Lus10010043.BGIv1.0 annot-version=v1.0 MDVRHRDSTSPTITSSNTENKRKHVVEKPYRGIRMRKWGKWVAEIREPNKRSRIWLGSYSTPVAAARAYDTAVFYLRGPSARLNFPDLIDHLTPPDHAVS AASIRQKATEIGAQVDALQTSTTTTPTSSSGDHSNVVIPENPDLNEYPNPENSDNEQE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G23340	AP2_ERF	DEAR3	DREB and EAR motif protein 3 (...		Lus10010043 [exp]	0	1
AT5G06710	HD	HAT14	homeobox from Arabidopsis thal...		Lus10039644 [exp]	4.9	0.8901
AT3G13340			Transducin/WD40 repeat-like su...		Lus10041268 [exp]	5.9	0.8188
AT2G33310	AUX_IAA	IAA13	auxin-induced protein 13 (.1.2...		Lus10023719 [exp]	5.9	0.8348
AT1G43650			nodulin MtN21 /EamA-like trans...		Lus10028585 [exp]	6.0	0.8444
AT5G53890		AtPSKR2	phytosylfokine-alpha receptor ...		Lus10009213 [exp]	8.9	0.8001
AT5G15240			Transmembrane amino acid trans...		Lus10012824 [exp]	9.7	0.7924
AT5G56190			Transducin/WD40 repeat-like su...		Lus10021975 [exp]	10.0	0.7910
AT5G24010			Protein kinase superfamily pro...		Lus10027509 [exp]	12.7	0.7730
AT5G63930			Leucine-rich repeat protein ki...		Lus10011761 [exp]	13.9	0.8220
AT2G40830		RHC1A	RING-H2 finger C1A (.1.2.3)		Lus10013235 [exp]	15.2	0.7302

Compare expression of checked genes

Lus10010043 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.