Lus10010533 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G26330 170 / 3e-54 Cupredoxin superfamily protein (.1)
AT2G26720 118 / 2e-33 Cupredoxin superfamily protein (.1)
AT2G31050 113 / 8e-32 Cupredoxin superfamily protein (.1)
AT2G32300 101 / 2e-26 UCC1 uclacyanin 1 (.1)
AT3G17675 92 / 1e-24 Cupredoxin superfamily protein (.1)
AT3G27200 86 / 3e-21 Cupredoxin superfamily protein (.1)
AT2G25060 84 / 2e-20 AtENODL14 early nodulin-like protein 14 (.1)
AT2G02850 82 / 2e-20 ARPN plantacyanin (.1)
AT4G31840 82 / 8e-20 AtENODL15 early nodulin-like protein 15 (.1)
AT5G07475 81 / 3e-19 Cupredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002451 235 / 2e-79 AT5G26330 136 / 2e-40 Cupredoxin superfamily protein (.1)
Lus10021925 220 / 1e-73 AT5G26330 170 / 5e-54 Cupredoxin superfamily protein (.1)
Lus10041211 218 / 5e-73 AT5G26330 167 / 6e-53 Cupredoxin superfamily protein (.1)
Lus10012165 96 / 4e-25 AT5G07475 89 / 1e-22 Cupredoxin superfamily protein (.1)
Lus10027143 94 / 5e-24 AT2G32300 137 / 9e-40 uclacyanin 1 (.1)
Lus10006657 96 / 9e-24 AT1G45063 106 / 1e-26 copper ion binding;electron carriers (.1.2)
Lus10022350 92 / 2e-23 AT3G27200 169 / 7e-54 Cupredoxin superfamily protein (.1)
Lus10007026 91 / 3e-23 AT2G32300 96 / 4e-25 uclacyanin 1 (.1)
Lus10002614 90 / 3e-23 AT2G32300 100 / 1e-26 uclacyanin 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G089900 194 / 1e-63 AT5G26330 187 / 7e-61 Cupredoxin superfamily protein (.1)
Potri.008G151000 191 / 3e-62 AT5G26330 183 / 2e-59 Cupredoxin superfamily protein (.1)
Potri.002G161300 144 / 2e-44 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1)
Potri.006G259000 143 / 9e-44 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1)
Potri.006G259101 143 / 1e-43 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1)
Potri.001G268700 139 / 3e-42 AT5G26330 138 / 6e-42 Cupredoxin superfamily protein (.1)
Potri.002G156100 139 / 3e-42 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1)
Potri.002G156401 139 / 3e-42 AT5G26330 138 / 1e-41 Cupredoxin superfamily protein (.1)
Potri.002G052500 128 / 7e-38 AT5G26330 130 / 9e-39 Cupredoxin superfamily protein (.1)
Potri.003G047300 114 / 1e-31 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10010533 pacid=23156640 polypeptide=Lus10010533 locus=Lus10010533.g ID=Lus10010533.BGIv1.0 annot-version=v1.0
ATGAAAATGGTGGCCAGAGCGTTTAGTTTGGCCACAGTGTTGTCAATGGCTGTGTTGTTGCAACAAGTGATCCATGCCCGTGGAGCAGCCGTCCACAAGG
TCGGAGACTCCGCCGGTTGGACCACCATTGGAAGTCCCGATTACAAGCAGTGGGCTGCTACTAAATCCTTCCATGTTGGCGACATTGTCCAATTCGAGTA
CAGCCCTCAGTTCCACAACGTGATGAGAGTGACCCACGCAATGTACAGAGCATGCAATGCCTCTGCTCCATTGGCAACATACACAACAGGGAATGATTCA
GTGAGCATAAGCACCCGCGGCCATCACTACTTCATCTGCGGAGTCAACGGCCATTGCCAGTCCGGCCAGAAGGTTGACATCAACGTCCTTCGTTCTTCAT
CTCCAGCTCCATCCTCCATGTCCGCCCCTCAAACTCTACCTTCTGCACAATCGCCTAGTCATTCTGCAAATTCAGCTTCTTCTACCTTTACTCTCACTCA
AGCAGCTGCTATTTCCCTCGCCTTCACTATCCTCGCCTCAGCTTGA
AA sequence
>Lus10010533 pacid=23156640 polypeptide=Lus10010533 locus=Lus10010533.g ID=Lus10010533.BGIv1.0 annot-version=v1.0
MKMVARAFSLATVLSMAVLLQQVIHARGAAVHKVGDSAGWTTIGSPDYKQWAATKSFHVGDIVQFEYSPQFHNVMRVTHAMYRACNASAPLATYTTGNDS
VSISTRGHHYFICGVNGHCQSGQKVDINVLRSSSPAPSSMSAPQTLPSAQSPSHSANSASSTFTLTQAAAISLAFTILASA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G26330 Cupredoxin superfamily protein... Lus10010533 0 1
AT5G39760 ZF_HD ATHB23, ZHD10 ZINC FINGER HOMEODOMAIN 10, ho... Lus10030473 4.0 0.9573
AT5G14070 ROXY2 Thioredoxin superfamily protei... Lus10003141 4.6 0.9654
AT5G15210 ZF_HD ATHB30, ZFHD3, ... ZINC FINGER HOMEODOMAIN 8, ZIN... Lus10036753 5.5 0.9366
AT3G57830 Leucine-rich repeat protein ki... Lus10023830 12.5 0.9471
AT2G33510 AtCFL1 unknown protein Lus10001804 13.3 0.9229
AT1G05490 CHR31 chromatin remodeling 31 (.1) Lus10011033 13.7 0.9212
AT1G23220 Dynein light chain type 1 fami... Lus10021793 18.2 0.9275
AT1G68400 leucine-rich repeat transmembr... Lus10035138 21.6 0.9282
AT5G14070 ROXY2 Thioredoxin superfamily protei... Lus10011333 21.6 0.9426
AT3G57830 Leucine-rich repeat protein ki... Lus10023831 22.3 0.9456

Lus10010533 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.