Lus10010876 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G29170 80 / 5e-21 NAD(P)-binding Rossmann-fold superfamily protein (.1)
AT2G29360 81 / 8e-20 NAD(P)-binding Rossmann-fold superfamily protein (.1)
AT2G29150 80 / 1e-19 NAD(P)-binding Rossmann-fold superfamily protein (.1)
AT2G29370 79 / 3e-19 NAD(P)-binding Rossmann-fold superfamily protein (.1)
AT2G29350 77 / 5e-19 SAG13 senescence-associated gene 13 (.1.2.3)
AT5G06060 78 / 8e-19 NAD(P)-binding Rossmann-fold superfamily protein (.1)
AT2G29260 77 / 2e-18 NAD(P)-binding Rossmann-fold superfamily protein (.1)
AT2G29290 76 / 3e-18 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2)
AT1G07440 70 / 2e-16 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2)
AT2G29340 69 / 7e-16 NAD-dependent epimerase/dehydratase family protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024359 122 / 6e-36 AT2G29360 314 / 2e-108 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Lus10010874 112 / 3e-32 AT5G06060 295 / 8e-101 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Lus10024360 99 / 6e-27 AT5G06060 287 / 7e-98 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Lus10040737 82 / 2e-20 AT2G29350 332 / 3e-115 senescence-associated gene 13 (.1.2.3)
Lus10040731 82 / 3e-20 AT5G06060 308 / 5e-106 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Lus10016498 79 / 2e-19 AT5G06060 351 / 7e-123 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Lus10040735 79 / 2e-19 AT5G06060 341 / 4e-119 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Lus10040732 76 / 2e-18 AT5G06060 269 / 7e-91 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Lus10040733 76 / 3e-18 AT5G06060 346 / 5e-121 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G026100 87 / 1e-22 AT2G29150 284 / 5e-97 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Potri.006G089800 87 / 3e-22 AT2G29150 307 / 2e-105 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Potri.001G245000 84 / 4e-21 AT2G29150 343 / 9e-120 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Potri.013G026000 83 / 5e-21 AT2G29290 362 / 2e-127 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2)
Potri.005G039300 81 / 3e-20 AT2G29150 356 / 7e-125 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Potri.005G039500 81 / 3e-20 AT2G29150 351 / 5e-123 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Potri.006G089700 80 / 1e-19 AT5G06060 320 / 6e-111 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Potri.010G142600 80 / 2e-19 AT2G29290 354 / 3e-124 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2)
Potri.001G244900 79 / 8e-19 AT2G29260 387 / 4e-135 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Potri.008G059100 75 / 7e-18 AT5G06060 416 / 8e-149 NAD(P)-binding Rossmann-fold superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0063 NADP_Rossmann PF00106 adh_short short chain dehydrogenase
Representative CDS sequence
>Lus10010876 pacid=23163455 polypeptide=Lus10010876 locus=Lus10010876.g ID=Lus10010876.BGIv1.0 annot-version=v1.0
ATGGCGACAACAGGAAGTATTGATGGCGAGTTAATCAGCAGCAGACATCCACGGTGGGCTCTTGAGGGAATGACTGCTCTCGTCACCGGTGGAACTCGAG
GCATTGGGCACGCCATTGTAGAGGAATTAGCAGAGTTGGGGGTTATGATCCACACTTGTGCTCGTACCGCTTCGCAACGACATAAACTCATCGAAAATGT
CTCCTCCGCCTTCAATGGGAAGCCCAACATTCTTGTTAGTATCCTTACTACATCGATCTAA
AA sequence
>Lus10010876 pacid=23163455 polypeptide=Lus10010876 locus=Lus10010876.g ID=Lus10010876.BGIv1.0 annot-version=v1.0
MATTGSIDGELISSRHPRWALEGMTALVTGGTRGIGHAIVEELAELGVMIHTCARTASQRHKLIENVSSAFNGKPNILVSILTTSI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G29360 NAD(P)-binding Rossmann-fold s... Lus10010876 0 1
Lus10035753 1.0 0.9156
AT1G02460 Pectin lyase-like superfamily ... Lus10038059 11.3 0.9009
AT5G42650 CYP74A, AOS, DD... DELAYED DEHISCENCE 2, CYTOCHRO... Lus10021015 13.3 0.8471
AT2G02061 Nucleotide-diphospho-sugar tra... Lus10031903 22.4 0.8836
AT5G09970 CYP78A7 "cytochrome P450, family 78, s... Lus10005780 23.8 0.8328
AT5G06490 RING/U-box superfamily protein... Lus10008972 25.0 0.8844
AT1G24430 HXXXD-type acyl-transferase fa... Lus10035932 25.8 0.8834
AT2G16750 Protein kinase protein with ad... Lus10019787 29.8 0.8803
Lus10012972 32.6 0.8688
AT1G75030 ATLP-3 thaumatin-like protein 3 (.1) Lus10032726 38.4 0.8793

Lus10010876 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.