Lus10011123 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G11590 137 / 1e-40 AP2_ERF DREB3, TINY2 TINY2, Integrase-type DNA-binding superfamily protein (.1)
AT4G32800 130 / 2e-38 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT5G25810 129 / 8e-38 AP2_ERF TNY, TINY TINY, Integrase-type DNA-binding superfamily protein (.1)
AT2G44940 129 / 3e-37 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT3G16280 127 / 6e-37 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT4G16750 124 / 4e-36 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT2G35700 122 / 2e-35 AP2_ERF ATERF38 ERF family protein 38 (.1)
AT2G25820 121 / 1e-34 AP2_ERF ESE2 ethylene and salt inducible 2, Integrase-type DNA-binding superfamily protein (.1)
AT3G60490 121 / 3e-34 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT1G01250 110 / 1e-30 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043240 150 / 1e-45 AT5G11590 176 / 1e-54 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Lus10034949 146 / 3e-43 AT4G32800 169 / 3e-51 Integrase-type DNA-binding superfamily protein (.1)
Lus10002801 130 / 4e-38 AT5G11590 209 / 4e-68 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Lus10038607 122 / 1e-35 AT5G11590 168 / 1e-52 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Lus10038270 120 / 2e-34 AT5G11590 168 / 4e-52 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Lus10001601 120 / 2e-34 AT5G11590 159 / 1e-48 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Lus10007799 113 / 1e-32 AT2G44940 136 / 7e-42 Integrase-type DNA-binding superfamily protein (.1)
Lus10004738 115 / 2e-32 AT2G35700 144 / 7e-44 ERF family protein 38 (.1)
Lus10025834 115 / 3e-32 AT5G11590 164 / 2e-50 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G085700 137 / 6e-40 AT4G32800 155 / 4e-46 Integrase-type DNA-binding superfamily protein (.1)
Potri.006G163400 135 / 1e-39 AT4G32800 159 / 6e-48 Integrase-type DNA-binding superfamily protein (.1)
Potri.018G043900 132 / 2e-38 AT5G11590 212 / 5e-69 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Potri.001G187500 130 / 4e-38 AT5G25810 157 / 9e-48 TINY, Integrase-type DNA-binding superfamily protein (.1)
Potri.003G050700 129 / 9e-38 AT5G11590 166 / 5e-51 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Potri.003G079300 127 / 8e-37 AT4G16750 150 / 7e-46 Integrase-type DNA-binding superfamily protein (.1)
Potri.014G055700 126 / 3e-36 AT2G44940 206 / 2e-65 Integrase-type DNA-binding superfamily protein (.1)
Potri.001G155700 125 / 9e-36 AT2G44940 159 / 1e-47 Integrase-type DNA-binding superfamily protein (.1)
Potri.002G141200 122 / 1e-34 AT2G44940 158 / 6e-47 Integrase-type DNA-binding superfamily protein (.1)
Potri.006G238600 113 / 3e-31 AT5G11590 199 / 8e-64 TINY2, Integrase-type DNA-binding superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0081 MBD-like PF00847 AP2 AP2 domain
Representative CDS sequence
>Lus10011123 pacid=23167573 polypeptide=Lus10011123 locus=Lus10011123.g ID=Lus10011123.BGIv1.0 annot-version=v1.0
ATGGCCGCTGCTGATTCTCCGCCACCACCCACTGCTTCCTCCTCCTCCTCCTCCTCCTCATCCTCCGGGTTTTCGGGTCAACCCATCCCCGACCCGGAAC
CTAATAAAACTAACAGTAATATTAATAATAATAAAAGTAAGCTGAAGAGAGGGAGAGGAGACGGCGGCTCCGGCGGCGGAGGGAGTGGGAGGACGACGAA
GCATCCAGTGTACAGAGGGGTGCGAATGAGGACGTGGGGCAAGTGGGTTTCCGAGATTCGGGAGCCCCGTAAGAAGAGCCGGATCTGGTTGGGCACTTTC
GCCACTCCTGAAATGGCGGCACGTGCTCACGACGTTGCCGCCTTGTCCATCAAAGGCCCCGCCGCCGCCGCCATACTTAACTTCCCCCAACTCTCCGCCT
CCCTCCCCCGGCCAGTCTCCAGCTCCCCCGCGACGTCCGGGCCGCTGCCCTCAAAGCCGCCTCCATGGACTTCCCCCCCACCACCGTGGCTACTACTCCG
GATAAGCTTTGCGAGATAG
AA sequence
>Lus10011123 pacid=23167573 polypeptide=Lus10011123 locus=Lus10011123.g ID=Lus10011123.BGIv1.0 annot-version=v1.0
MAAADSPPPPTASSSSSSSSSSGFSGQPIPDPEPNKTNSNINNNKSKLKRGRGDGGSGGGGSGRTTKHPVYRGVRMRTWGKWVSEIREPRKKSRIWLGTF
ATPEMAARAHDVAALSIKGPAAAAILNFPQLSASLPRPVSSSPATSGPLPSKPPPWTSPPPPWLLLRISFAR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G11590 AP2_ERF DREB3, TINY2 TINY2, Integrase-type DNA-bind... Lus10011123 0 1
AT1G50720 Stigma-specific Stig1 family p... Lus10011146 2.6 0.9674
AT5G54370 Late embryogenesis abundant (L... Lus10038588 5.8 0.9497
AT5G45120 Eukaryotic aspartyl protease f... Lus10018286 6.0 0.9328
AT5G44390 FAD-binding Berberine family p... Lus10026775 10.0 0.9213
AT5G60520 Late embryogenesis abundant (L... Lus10015149 10.5 0.9306
AT5G54370 Late embryogenesis abundant (L... Lus10037886 14.4 0.9318
AT2G42570 TBL39 TRICHOME BIREFRINGENCE-LIKE 39... Lus10033617 16.0 0.9084
AT5G15490 UGD3 UDP-glucose dehydrogenase 3, U... Lus10021626 17.7 0.8920
AT5G15490 UGD3 UDP-glucose dehydrogenase 3, U... Lus10034703 18.5 0.9200
AT5G60520 Late embryogenesis abundant (L... Lus10031532 20.0 0.9269

Lus10011123 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.