Lus10011158 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G20570 147 / 1e-44 AtENODL9 early nodulin-like protein 9 (.1)
AT5G53870 116 / 6e-31 AtENODL1 early nodulin-like protein 1 (.1)
AT4G31840 111 / 7e-31 AtENODL15 early nodulin-like protein 15 (.1)
AT2G25060 110 / 3e-30 AtENODL14 early nodulin-like protein 14 (.1)
AT4G30590 105 / 2e-28 AtENODL12 early nodulin-like protein 12 (.1)
AT4G27520 104 / 1e-26 AtENODL2 early nodulin-like protein 2 (.1)
AT4G28365 100 / 2e-26 AtENODL3 early nodulin-like protein 3 (.1)
AT5G25090 98 / 2e-25 AtENODL13 early nodulin-like protein 13 (.1)
AT5G57920 92 / 2e-23 AtENODL10 early nodulin-like protein 10 (.1)
AT4G32490 92 / 8e-23 AtENODL4 early nodulin-like protein 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043063 271 / 4e-93 AT3G20570 153 / 4e-47 early nodulin-like protein 9 (.1)
Lus10003432 107 / 4e-29 AT5G25090 167 / 5e-53 early nodulin-like protein 13 (.1)
Lus10026880 106 / 1e-28 AT5G25090 167 / 8e-53 early nodulin-like protein 13 (.1)
Lus10018617 105 / 3e-28 AT4G28365 150 / 5e-46 early nodulin-like protein 3 (.1)
Lus10039852 105 / 3e-28 AT4G28365 150 / 8e-46 early nodulin-like protein 3 (.1)
Lus10022318 104 / 5e-28 AT3G18590 146 / 4e-45 early nodulin-like protein 5 (.1)
Lus10014880 102 / 4e-27 AT3G18590 144 / 1e-43 early nodulin-like protein 5 (.1)
Lus10032111 100 / 3e-26 AT5G14345 147 / 1e-45 early nodulin-like protein 21 (.1)
Lus10036257 93 / 7e-24 AT2G25060 110 / 3e-31 early nodulin-like protein 14 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G419200 162 / 4e-50 AT3G20570 153 / 1e-46 early nodulin-like protein 9 (.1)
Potri.011G135400 158 / 6e-49 AT3G20570 138 / 4e-41 early nodulin-like protein 9 (.1)
Potri.011G117800 115 / 8e-31 AT5G53870 158 / 3e-45 early nodulin-like protein 1 (.1)
Potri.017G011200 110 / 3e-30 AT4G32490 157 / 2e-48 early nodulin-like protein 4 (.1)
Potri.001G398800 114 / 5e-30 AT4G28365 145 / 9e-42 early nodulin-like protein 3 (.1)
Potri.006G184100 107 / 3e-29 AT4G31840 174 / 5e-56 early nodulin-like protein 15 (.1)
Potri.006G264600 103 / 1e-27 AT2G25060 184 / 9e-60 early nodulin-like protein 14 (.1)
Potri.018G018200 100 / 2e-26 AT2G25060 177 / 7e-57 early nodulin-like protein 14 (.1)
Potri.001G338800 98 / 1e-25 AT5G14345 145 / 6e-45 early nodulin-like protein 21 (.1)
Potri.001G187700 91 / 1e-22 AT1G79800 176 / 2e-56 early nodulin-like protein 7 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10011158 pacid=23167540 polypeptide=Lus10011158 locus=Lus10011158.g ID=Lus10011158.BGIv1.0 annot-version=v1.0
ATGGCAACAACAGGGTCGAAATTCGCGGTTGGTGTGCTGGGACTCTCCTGTCTTATGCTCTTGTCCGTCCAGAAAGCCACTGCATTCCAGTTCACCGTCG
GAGGTGCCAAAGGTTGGATCGTTCCTGATAATTCCTCCGGCTTGAACTACAATTCTTGGGCCGAGAGCAGTCGCTTCTCCGTCGGAGACTCCATCGTGTT
TGTGTACGACCATGCTCACGACTCAGTGCTGGAAGTGAGCAAGGCCGACTACGACAGCTGCACTACGAGTTCCCCGGCCGGAACCTACACCGACGGCCAC
ACGGTCTTCACTTTCAACCACTCGGGGGCACATTACTTCATCAGTGGCAACAAAGACCACTGCCTCAAGAATCAGAAGGTCGTCATTGTAGTTTTGGCTG
ACAGAAGCAGCAAACCACCGTCTCCCTCCACTCCTCCTCCATCACCAGCACCGGCCACCGACTACTCGCCTCCGGCACTCCAGCTCACCCCTGTCTCGCC
TCCTGAAGGGTATTCGCCACACAATGCAGCATCATCTTCCATGACAGCTGCGGCAGGAGTAATTGCTTCTGCCGGAGCCTTCATGGCCTCTTCCCTGGTT
TTCACATTCTGA
AA sequence
>Lus10011158 pacid=23167540 polypeptide=Lus10011158 locus=Lus10011158.g ID=Lus10011158.BGIv1.0 annot-version=v1.0
MATTGSKFAVGVLGLSCLMLLSVQKATAFQFTVGGAKGWIVPDNSSGLNYNSWAESSRFSVGDSIVFVYDHAHDSVLEVSKADYDSCTTSSPAGTYTDGH
TVFTFNHSGAHYFISGNKDHCLKNQKVVIVVLADRSSKPPSPSTPPPSPAPATDYSPPALQLTPVSPPEGYSPHNAASSSMTAAAGVIASAGAFMASSLV
FTF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G20570 AtENODL9 early nodulin-like protein 9 (... Lus10011158 0 1
AT3G05620 Plant invertase/pectin methyle... Lus10020677 1.0 0.9852
AT3G20570 AtENODL9 early nodulin-like protein 9 (... Lus10043063 1.4 0.9809
AT1G14730 Cytochrome b561/ferric reducta... Lus10031935 1.7 0.9786
AT1G29380 Carbohydrate-binding X8 domain... Lus10004600 3.5 0.9728
AT5G22870 Late embryogenesis abundant (L... Lus10021404 3.5 0.9664
AT5G22870 Late embryogenesis abundant (L... Lus10016161 3.9 0.9685
AT5G48060 C2 calcium/lipid-binding plant... Lus10037479 4.4 0.9408
AT1G79480 Carbohydrate-binding X8 domain... Lus10001764 5.8 0.9429
AT3G05620 Plant invertase/pectin methyle... Lus10029868 5.9 0.9628
AT1G60360 RING/U-box superfamily protein... Lus10028063 6.0 0.9517

Lus10011158 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.