Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17600 68 / 2e-14 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G48770 65 / 2e-13 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G27170 62 / 2e-12 transmembrane receptors;ATP binding (.1.2) AT5G38850 61 / 8e-12 Disease resistance protein (TIR-NBS-LRR class) (.1) AT1G63860 60 / 1e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT5G17680 60 / 1e-11 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT5G41540 60 / 1e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G41750 59 / 3e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT4G11170 58 / 7e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G58120 58 / 7e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038482 [exp] 145 / 1e-41 AT1G69550 386 / 3e-113 disease resistance protein (TIR-NBS-LRR class) (.1) Lus10023272 [exp] 127 / 3e-35 AT5G36930 423 / 4e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10018309 [exp] 124 / 4e-35 AT1G27180 245 / 1e-71 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10042714 [exp] 125 / 2e-34 AT5G36930 411 / 3e-124 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10004115 [exp] 121 / 3e-33 AT5G27970 689 / 0.0 ARM repeat superfamily protein (.1.2) Lus10026961 [exp] 120 / 8e-33 AT5G36930 420 / 2e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10017143 [exp] 120 / 9e-33 AT1G27180 387 / 6e-116 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10029628 [exp] 120 / 9e-33 AT1G27180 462 / 1e-138 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10037406 [exp] 117 / 1e-31 AT5G36930 395 / 5e-116 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G206400 [exp] 77 / 1e-17 AT5G36930 587 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.017G010800 [exp] 77 / 1e-17 AT5G17680 592 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G068200 [exp] 77 / 2e-17 AT5G17680 629 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G001602 [exp] 76 / 2e-17 AT5G36930 778 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.001G307300 [exp] 74 / 1e-16 AT5G17680 597 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.001G066500 [exp] 73 / 2e-16 AT5G36930 462 / 2e-146 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G001600 [exp] 73 / 2e-16 AT5G36930 721 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T011750 [exp] 71 / 2e-15 AT5G36930 551 / 2e-176 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.003G084333 [exp] 69 / 6e-15 AT5G36930 347 / 2e-108 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G002500 [exp] 69 / 8e-15 AT5G17680 587 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00931 [flax] [poplar] NB-ARC NB-ARC domain
Representative CDS sequence Show only first row Show all	>Lus10011241 pacid=23147159 polypeptide=Lus10011241 locus=Lus10011241.g ID=Lus10011241.BGIv1.0 annot-version=v1.0 ATGGAGAATTACAAGTTAGTGACTAGCAAGTTGGTTGGAATGAATCCTCATGTGGAACAAGTGACGGGACTACTGAAGAAAGATGAGAAAATTGTTGGCA TTGTTGGAATGAGTGGCATTGGTAAAACCACTATAGCCAAGGCTGTCTGTCACAGCGTTTGTGATCAGTTTGATCGATTGTGTTTTGTGGAAGATGTGCG AGAAACATTGAAGAGTGGCGGTATTGTTGCTTTACAAAACAAGATTTTATCTAGCATTCTGAGGAAGGATATCAAGGTGACAGATGCTAGTCAAGGAATC AGCACAATTAAAGACAGAGTTGACTGA
AA sequence Show only first row Show all	>Lus10011241 pacid=23147159 polypeptide=Lus10011241 locus=Lus10011241.g ID=Lus10011241.BGIv1.0 annot-version=v1.0 MENYKLVTSKLVGMNPHVEQVTGLLKKDEKIVGIVGMSGIGKTTIAKAVCHSVCDQFDRLCFVEDVRETLKSGGIVALQNKILSSILRKDIKVTDASQGI STIKDRVD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G27170			transmembrane receptors;ATP bi...		Lus10011241 [exp]	0	1
AT5G36930			Disease resistance protein (TI...		Lus10011240 [exp]	1.0	0.8991
AT5G44510		TAO1	target of AVRB operation1 (.1)		Lus10011242 [exp]	2.4	0.8162
AT3G62930			Thioredoxin superfamily protei...		Lus10029441 [exp]	11.5	0.7155
AT5G55530			Calcium-dependent lipid-bindin...		Lus10043169 [exp]	19.1	0.7281
AT1G06510			unknown protein		Lus10031459 [exp]	20.8	0.7154
					Lus10029627 [exp]	22.4	0.7222
AT5G10010			unknown protein		Lus10006744 [exp]	22.5	0.6958
AT3G62930			Thioredoxin superfamily protei...		Lus10005941 [exp]	24.8	0.7205
					Lus10030127 [exp]	29.7	0.6823
AT5G21280			hydroxyproline-rich glycoprote...		Lus10038083 [exp]	37.9	0.6278

Compare expression of checked genes

Lus10011241 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.