Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G76860 132 / 7e-42 Small nuclear ribonucleoprotein family protein (.1) AT1G21190 131 / 2e-41 Small nuclear ribonucleoprotein family protein (.1) AT3G62840 41 / 1e-05 Small nuclear ribonucleoprotein family protein (.1.2) AT2G47640 41 / 1e-05 Small nuclear ribonucleoprotein family protein (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040487 [exp] 151 / 3e-49 AT1G76860 175 / 8e-59 Small nuclear ribonucleoprotein family protein (.1) Lus10026326 [exp] 150 / 1e-48 AT1G76860 176 / 4e-59 Small nuclear ribonucleoprotein family protein (.1) Lus10042341 [exp] 100 / 7e-29 AT1G76860 132 / 2e-41 Small nuclear ribonucleoprotein family protein (.1) Lus10030367 [exp] 38 / 0.0002 AT2G47640 185 / 2e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4) Lus10007876 [exp] 38 / 0.0002 AT2G47640 185 / 2e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4) Lus10026556 [exp] 37 / 0.0003 AT2G47640 184 / 3e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4) Lus10013840 [exp] 37 / 0.0003 AT2G47640 184 / 3e-62 Small nuclear ribonucleoprotein family protein (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G191600 [exp] 142 / 7e-46 AT1G76860 176 / 3e-59 Small nuclear ribonucleoprotein family protein (.1) Potri.002G068800 [exp] 142 / 7e-46 AT1G76860 175 / 1e-58 Small nuclear ribonucleoprotein family protein (.1) Potri.002G204300 [exp] 40 / 3e-05 AT3G62840 204 / 6e-70 Small nuclear ribonucleoprotein family protein (.1.2) Potri.014G129100 [exp] 40 / 3e-05 AT3G62840 204 / 6e-70 Small nuclear ribonucleoprotein family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [flax] [poplar] Sm-like PF01423 [flax] [poplar] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Lus10011293 pacid=23149940 polypeptide=Lus10011293 locus=Lus10011293.g ID=Lus10011293.BGIv1.0 annot-version=v1.0 ATGGCGACCGAAGAGGAGAGTGCAGTTAAGGAGCCATTGGATCTCATCCGCCTCAGTCTCGACGAGCGCATCTACGTCAAGCTCCGCTCCGACCGTGAGC TCCGCGGCAAGCTTCATGCTTACGACCAACATTTGAATATGATCCTCGGGGACGTCGAGGAAACTGTGACTACTGTGGAGATTGACGATGAAACTTACGA AGAGATTGTCAGGCACACGAAGCGCAATGTACCGTTCCTGTTCGTCAGGGGAGACGGAGTTATACTTGTTTCTCCACCATTGAGGACAGCTTGA
AA sequence Show only first row Show all	>Lus10011293 pacid=23149940 polypeptide=Lus10011293 locus=Lus10011293.g ID=Lus10011293.BGIv1.0 annot-version=v1.0 MATEEESAVKEPLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMILGDVEETVTTVEIDDETYEEIVRHTKRNVPFLFVRGDGVILVSPPLRTA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G76860			Small nuclear ribonucleoprotei...		Lus10011293 [exp]	0	1
AT3G05070			unknown protein		Lus10026367 [exp]	1.4	0.9187
AT2G27970		CKS2	CDK-subunit 2 (.1)		Lus10021405 [exp]	2.0	0.8840
AT2G27470	CCAAT	NF-YB11	"nuclear factor Y, subunit B11...		Lus10020621 [exp]	3.0	0.8532
AT2G30620			winged-helix DNA-binding trans...		Lus10022001 [exp]	3.5	0.8617
AT5G40580		PBB2	20S proteasome beta subunit PB...		Lus10014581 [exp]	3.5	0.8714
AT5G07960			unknown protein		Lus10034695 [exp]	4.5	0.8676
AT2G40390			unknown protein		Lus10017423 [exp]	4.9	0.8209
AT1G76860			Small nuclear ribonucleoprotei...		Lus10040487 [exp]	6.3	0.8687
AT3G17210		ATHS1	A. THALIANA HEAT STABLE PROTEI...		Lus10037823 [exp]	6.3	0.8558
AT2G47640			Small nuclear ribonucleoprotei...		Lus10013840 [exp]	7.1	0.8345

Compare expression of checked genes

Lus10011293 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.