Lus10011433 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G79800 115 / 2e-32 AtENODL7 early nodulin-like protein 7 (.1)
AT3G20570 85 / 1e-20 AtENODL9 early nodulin-like protein 9 (.1)
AT3G18590 84 / 2e-20 AtENODL5 early nodulin-like protein 5 (.1)
AT5G14345 81 / 1e-19 AtENODL21 early nodulin-like protein 21 (.1)
AT2G25060 81 / 2e-19 AtENODL14 early nodulin-like protein 14 (.1)
AT1G48940 81 / 3e-19 AtENODL6 early nodulin-like protein 6 (.1)
AT5G57920 79 / 2e-18 AtENODL10 early nodulin-like protein 10 (.1)
AT3G60280 78 / 8e-18 UCC3 uclacyanin 3 (.1)
AT4G30590 77 / 1e-17 AtENODL12 early nodulin-like protein 12 (.1)
AT4G31840 77 / 2e-17 AtENODL15 early nodulin-like protein 15 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037575 230 / 3e-77 AT1G79800 127 / 4e-37 early nodulin-like protein 7 (.1)
Lus10024846 147 / 7e-45 AT1G79800 147 / 1e-44 early nodulin-like protein 7 (.1)
Lus10018758 144 / 6e-44 AT1G79800 142 / 2e-43 early nodulin-like protein 7 (.1)
Lus10009617 86 / 8e-21 AT3G18590 148 / 1e-45 early nodulin-like protein 5 (.1)
Lus10012085 81 / 4e-19 AT5G07475 142 / 4e-43 Cupredoxin superfamily protein (.1)
Lus10018617 80 / 2e-18 AT4G28365 150 / 5e-46 early nodulin-like protein 3 (.1)
Lus10039852 79 / 2e-18 AT4G28365 150 / 8e-46 early nodulin-like protein 3 (.1)
Lus10003432 79 / 4e-18 AT5G25090 167 / 5e-53 early nodulin-like protein 13 (.1)
Lus10022522 79 / 5e-18 AT3G18590 95 / 2e-24 early nodulin-like protein 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G187700 121 / 6e-35 AT1G79800 176 / 2e-56 early nodulin-like protein 7 (.1)
Potri.003G050500 117 / 4e-33 AT1G79800 162 / 1e-50 early nodulin-like protein 7 (.1)
Potri.006G264600 86 / 4e-21 AT2G25060 184 / 9e-60 early nodulin-like protein 14 (.1)
Potri.002G161300 86 / 5e-21 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1)
Potri.017G011200 85 / 2e-20 AT4G32490 157 / 2e-48 early nodulin-like protein 4 (.1)
Potri.006G184100 84 / 2e-20 AT4G31840 174 / 5e-56 early nodulin-like protein 15 (.1)
Potri.011G117800 87 / 3e-20 AT5G53870 158 / 3e-45 early nodulin-like protein 1 (.1)
Potri.018G018200 84 / 3e-20 AT2G25060 177 / 7e-57 early nodulin-like protein 14 (.1)
Potri.011G135400 84 / 4e-20 AT3G20570 138 / 4e-41 early nodulin-like protein 9 (.1)
Potri.006G259101 81 / 4e-19 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10011433 pacid=23182628 polypeptide=Lus10011433 locus=Lus10011433.g ID=Lus10011433.BGIv1.0 annot-version=v1.0
ATGAACTACTCTTATGAACCAGCCGTGGGTCTCTTCGTCTTCTTCGTTGTCTTCAACTCGGCCGCTTACTGCGAAGCAACGGTGTTCAAGGTTGGCGATG
GCTTCGGATGGCAGCAGCCAACGACAAACACCACTACTCAACTTTACTACACTCACTGGGCTACCAATCACAGATTCCAAGTCGGAGATTCCCTCCTGTT
CGAGTACAAGAACGATTCAGTGGCAAAGGTCGACGAATGGGGATACAGCCACTGCAACGCTAGCACATCCATGGAAGTTTTCTACGATGGGAACAGCAGC
TTTGTGCTCGAGAAGCCTGGACCTTTCTACTTCATCAGTGGGCACTTCGGCCATTGCCAGAACGGAATGGTGCTTCTTGTCGAAGTCATGCACCAGCGCC
GTCACGATAGCATGGCTCCCGAGGCGGAGTATGCTAATCCACCTGAAGGGTCTTCGTCGGAGTCTTCTCCTTCCTCGTCCATGGAGCCACGACAGCCGAG
TTCGGCAGCGATCGTGTCGGTTATAGTCAGTTCAGTCACTGTTGTCCTTATCGCTACATTCGTCGCTCTGGCGTGGTGTTCGCCGTGA
AA sequence
>Lus10011433 pacid=23182628 polypeptide=Lus10011433 locus=Lus10011433.g ID=Lus10011433.BGIv1.0 annot-version=v1.0
MNYSYEPAVGLFVFFVVFNSAAYCEATVFKVGDGFGWQQPTTNTTTQLYYTHWATNHRFQVGDSLLFEYKNDSVAKVDEWGYSHCNASTSMEVFYDGNSS
FVLEKPGPFYFISGHFGHCQNGMVLLVEVMHQRRHDSMAPEAEYANPPEGSSSESSPSSSMEPRQPSSAAIVSVIVSSVTVVLIATFVALAWCSP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G79800 AtENODL7 early nodulin-like protein 7 (... Lus10011433 0 1
AT5G04550 Protein of unknown function (D... Lus10002840 2.0 0.7264
AT3G02920 ATRPA32B Replication protein A, subunit... Lus10015505 6.9 0.7201
AT1G72570 AP2_ERF Integrase-type DNA-binding sup... Lus10037670 6.9 0.7688
AT5G27510 Protein kinase superfamily pro... Lus10034285 8.9 0.7059
AT2G27410 B3 Domain of unknown function (DU... Lus10035393 8.9 0.6970
AT3G58060 Cation efflux family protein (... Lus10029300 20.1 0.7010
AT4G30380 EXLB2 Barwin-related endoglucanase (... Lus10013118 23.9 0.7502
AT1G13340 Regulator of Vps4 activity in ... Lus10017591 27.1 0.7033
AT4G35190 LOG5 LONELY GUY 5, Putative lysine ... Lus10025117 29.0 0.6992
AT3G58690 Protein kinase superfamily pro... Lus10033606 30.4 0.7230

Lus10011433 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.