Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G23230 131 / 5e-40 AP2_ERF ERF98 Integrase-type DNA-binding superfamily protein (.1) AT5G43410 112 / 1e-32 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G61600 107 / 2e-29 AP2_ERF ERF104 ethylene response factor 104 (.1) AT5G51190 105 / 9e-29 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT2G44840 102 / 1e-27 AP2_ERF ATERF13, EREBP ethylene-responsive element binding factor 13 (.1) AT5G47230 103 / 2e-27 AP2_ERF ATERF5, ATERF-5, ERF5 ETHYLENE RESPONSIVE ELEMENT BINDING FACTOR- 5, ethylene responsive element binding factor 5 (.1) AT1G04370 99 / 2e-27 AP2_ERF ATERF14 Ethylene-responsive element binding factor 14 (.1) AT4G17490 100 / 2e-26 AP2_ERF ERF-6-6, ATERF6 ethylene responsive element binding factor 6 (.1) AT4G17500 99 / 4e-26 AP2_ERF ATERF-1, AtERF1 ethylene responsive element binding factor 1 (.1) AT3G23240 98 / 4e-26 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021873 [exp] 137 / 1e-41 AT3G23230 143 / 4e-44 Integrase-type DNA-binding superfamily protein (.1) Lus10022936 [exp] 112 / 8e-33 AT3G23230 114 / 9e-34 Integrase-type DNA-binding superfamily protein (.1) Lus10033884 [exp] 108 / 8e-31 AT3G23230 125 / 9e-38 Integrase-type DNA-binding superfamily protein (.1) Lus10042996 [exp] 105 / 1e-28 AT5G51190 189 / 6e-60 Integrase-type DNA-binding superfamily protein (.1) Lus10011831 [exp] 102 / 1e-28 AT3G23230 132 / 2e-40 Integrase-type DNA-binding superfamily protein (.1) Lus10032499 [exp] 105 / 2e-28 AT5G51190 186 / 8e-59 Integrase-type DNA-binding superfamily protein (.1) Lus10013959 [exp] 101 / 3e-28 AT3G23240 124 / 2e-36 ethylene response factor 1 (.1) Lus10021196 [exp] 101 / 3e-28 AT3G23230 131 / 3e-40 Integrase-type DNA-binding superfamily protein (.1) Lus10006579 [exp] 103 / 4e-28 AT3G23240 211 / 4e-69 ethylene response factor 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G166100 [exp] 132 / 4e-40 AT3G23230 82 / 2e-20 Integrase-type DNA-binding superfamily protein (.1) Potri.010G072400 [exp] 126 / 6e-38 AT3G23230 85 / 1e-21 Integrase-type DNA-binding superfamily protein (.1) Potri.005G223100 [exp] 124 / 4e-37 AT3G23230 101 / 2e-28 Integrase-type DNA-binding superfamily protein (.1) Potri.002G039200 [exp] 122 / 2e-36 AT3G23230 113 / 7e-33 Integrase-type DNA-binding superfamily protein (.1) Potri.002G039300 [exp] 108 / 8e-31 AT3G23220 82 / 2e-20 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1) Potri.003G150800 [exp] 109 / 7e-30 AT5G51190 185 / 7e-58 Integrase-type DNA-binding superfamily protein (.1) Potri.003G080600 [exp] 109 / 2e-29 AT4G17490 159 / 3e-46 ethylene responsive element binding factor 6 (.1) Potri.004G051700 [exp] 105 / 2e-29 AT5G47220 111 / 1e-30 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1) Potri.001G154200 [exp] 107 / 2e-28 AT4G17490 159 / 2e-46 ethylene responsive element binding factor 6 (.1) Potri.001G079800 [exp] 106 / 2e-28 AT5G51190 186 / 2e-58 Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10011830 pacid=23165552 polypeptide=Lus10011830 locus=Lus10011830.g ID=Lus10011830.BGIv1.0 annot-version=v1.0 ATGGAGGCCAGGAAAAGCATTATTAGTGGTGGCGAAGATGAGCATCATCAGCAGGAAGTGAAGTATCGGGGTGTGCGGCGGAGACCGTGGGGGAAGTACG CGGCAGAGATACGTGACCCGGCGAGGCGAGGCTGCAGGCTGTGGCTGGGTACTTACGACACTGGGGAGGAGGCAGCTCGTGCTTATGACAGAGCAGCCTT CGACATCAGAGGAAACCTCGCCATCCTCAACTTTCCGAACGAGTATTACTTGCGGCGCCCGAGTAGTAGTAGTCCTAATAATGTCGCCGGTGGCCGTGAC GGGCGAGATTTGGAGGACGAAGGAGGGAGAAAGAAAGAGAAGCAGGTGTTGGAGTTGGAGTACTTGGATGACAGCGTGCTGGATGAGCTTCTTCAACATT CACTGCAAGAAGATAATCACAAATCACAAACTGAAGAGTAA
AA sequence Show only first row Show all	>Lus10011830 pacid=23165552 polypeptide=Lus10011830 locus=Lus10011830.g ID=Lus10011830.BGIv1.0 annot-version=v1.0 MEARKSIISGGEDEHHQQEVKYRGVRRRPWGKYAAEIRDPARRGCRLWLGTYDTGEEAARAYDRAAFDIRGNLAILNFPNEYYLRRPSSSSPNNVAGGRD GRDLEDEGGRKKEKQVLELEYLDDSVLDELLQHSLQEDNHKSQTEE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G23230	AP2_ERF	ERF98	Integrase-type DNA-binding sup...		Lus10011830 [exp]	0	1
AT5G39160			RmlC-like cupins superfamily p...		Lus10021980 [exp]	1.0	0.9950
					Lus10041164 [exp]	2.0	0.9854
AT5G09360		LAC14	laccase 14 (.1)		Lus10041067 [exp]	3.9	0.9770
AT3G61680			alpha/beta-Hydrolases superfam...		Lus10009811 [exp]	4.5	0.9550
AT1G78410			VQ motif-containing protein (....		Lus10023308 [exp]	6.3	0.9603
AT1G58170			Disease resistance-responsive ...		Lus10017231 [exp]	6.6	0.9401
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10032406 [exp]	8.5	0.9310
AT5G67550			unknown protein		Lus10025583 [exp]	10.0	0.9710
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Lus10042907 [exp]	11.7	0.8959
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Lus10021312 [exp]	12.7	0.9635

Compare expression of checked genes

Lus10011830 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.