Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G04370 110 / 3e-32 AP2_ERF ATERF14 Ethylene-responsive element binding factor 14 (.1) AT5G43410 97 / 9e-27 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT3G23230 96 / 3e-26 AP2_ERF ERF98 Integrase-type DNA-binding superfamily protein (.1) AT3G23220 84 / 9e-22 AP2_ERF ESE1 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1) AT3G23240 82 / 3e-20 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1) AT2G31230 81 / 2e-19 AP2_ERF ATERF15 ethylene-responsive element binding factor 15 (.1) AT1G06160 80 / 4e-19 AP2_ERF ORA59 octadecanoid-responsive Arabidopsis AP2/ERF 59 (.1) AT2G44840 76 / 1e-17 AP2_ERF ATERF13, EREBP ethylene-responsive element binding factor 13 (.1) AT5G07580 76 / 2e-17 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G61590 74 / 3e-17 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021196 [exp] 157 / 2e-50 AT3G23230 131 / 3e-40 Integrase-type DNA-binding superfamily protein (.1) Lus10011830 [exp] 97 / 2e-26 AT3G23230 134 / 4e-41 Integrase-type DNA-binding superfamily protein (.1) Lus10021873 [exp] 88 / 1e-22 AT3G23230 143 / 4e-44 Integrase-type DNA-binding superfamily protein (.1) Lus10033884 [exp] 85 / 7e-22 AT3G23230 125 / 9e-38 Integrase-type DNA-binding superfamily protein (.1) Lus10022936 [exp] 82 / 4e-21 AT3G23230 114 / 9e-34 Integrase-type DNA-binding superfamily protein (.1) Lus10024883 [exp] 82 / 1e-20 AT3G23230 130 / 3e-39 Integrase-type DNA-binding superfamily protein (.1) Lus10006579 [exp] 81 / 2e-19 AT3G23240 211 / 4e-69 ethylene response factor 1 (.1) Lus10042557 [exp] 80 / 2e-19 AT3G23240 155 / 7e-48 ethylene response factor 1 (.1) Lus10011829 [exp] 81 / 3e-19 AT3G23240 209 / 4e-68 ethylene response factor 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G039200 [exp] 99 / 1e-27 AT3G23230 113 / 7e-33 Integrase-type DNA-binding superfamily protein (.1) Potri.010G072600 [exp] 92 / 7e-25 AT3G23220 91 / 4e-24 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1) Potri.005G223100 [exp] 92 / 1e-24 AT3G23230 101 / 2e-28 Integrase-type DNA-binding superfamily protein (.1) Potri.010G072400 [exp] 92 / 1e-24 AT3G23230 85 / 1e-21 Integrase-type DNA-binding superfamily protein (.1) Potri.008G166000 [exp] 89 / 1e-23 AT3G23230 94 / 3e-25 Integrase-type DNA-binding superfamily protein (.1) Potri.008G166100 [exp] 88 / 4e-23 AT3G23230 82 / 2e-20 Integrase-type DNA-binding superfamily protein (.1) Potri.002G039300 [exp] 88 / 5e-23 AT3G23220 82 / 2e-20 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1) Potri.013G045200 [exp] 86 / 2e-21 AT3G23240 167 / 5e-52 ethylene response factor 1 (.1) Potri.005G223200 [exp] 85 / 4e-21 AT3G23240 165 / 4e-51 ethylene response factor 1 (.1) Potri.001G079600 [exp] 84 / 1e-20 AT5G07580 145 / 1e-42 Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10011831 pacid=23165516 polypeptide=Lus10011831 locus=Lus10011831.g ID=Lus10011831.BGIv1.0 annot-version=v1.0 ATGGACAATCAAGCAACAGGTGAAGAAGAAGGCGGAGGAGGAGGAGGAGGAGGAGGAGAGGTGAAGTACAGAGGAGTCCGGCGCCGCCCTTGGGGGAAAT TCGCTGCGGAGATACGAGACTCGACGAGGAACGGGCAGAGGATATGGCTGGGGACATTCGACAGTGCGGAGGAAGCAGCAAGAGCATACGACCGTGCTGC GTATGCGATGAGGGGACACATTGCTGTCCTCAACTTCCCACATGAGTACCCCATGGGGAGGGGCCCGGCTTCTGCTGCCGCGTCTGCAGCTGCCGGATCG TCATCGAATTCGAGACAAGTGGTGGAGTTGGAGTACTTGGACAATAGGTTGCTGGATGAGATGCTGGAGCAAGAAGAGAATCGGAGGAGGAGGCACGGCT AG
AA sequence Show only first row Show all	>Lus10011831 pacid=23165516 polypeptide=Lus10011831 locus=Lus10011831.g ID=Lus10011831.BGIv1.0 annot-version=v1.0 MDNQATGEEEGGGGGGGGGEVKYRGVRRRPWGKFAAEIRDSTRNGQRIWLGTFDSAEEAARAYDRAAYAMRGHIAVLNFPHEYPMGRGPASAAASAAAGS SSNSRQVVELEYLDNRLLDEMLEQEENRRRRHG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G23230	AP2_ERF	ERF98	Integrase-type DNA-binding sup...		Lus10011831 [exp]	0	1
AT1G28380		NSL1	necrotic spotted lesions 1, MA...		Lus10025453 [exp]	4.0	0.7684
AT3G14040			Pectin lyase-like superfamily ...		Lus10038316 [exp]	11.2	0.7163
AT3G62550			Adenine nucleotide alpha hydro...		Lus10010013 [exp]	17.9	0.6804
AT3G59510			Leucine-rich repeat (LRR) fami...		Lus10025578 [exp]	19.1	0.6188
AT1G65390		ATPP2-A5	phloem protein 2 A5 (.1.2)		Lus10018303 [exp]	24.1	0.7354
AT1G45688			unknown protein		Lus10034926 [exp]	26.0	0.7204
AT4G11600		LSC803, PHGPX, ...	glutathione peroxidase 6 (.1)		Lus10008022 [exp]	26.5	0.7008
AT3G17980		AtC2	Arabidopsis thaliana C2 domain...		Lus10009053 [exp]	30.5	0.6812
AT5G07480		KUOX1	KAR-UP oxidoreductase 1 (.1)		Lus10043000 [exp]	30.6	0.6938
AT2G39770		VTC1, SOZ1, GMP...	VITAMIN C DEFECTIVE 1, SENSITI...		Lus10028418 [exp]	32.2	0.6828

Compare expression of checked genes

Lus10011831 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.