Lus10011877 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G48870 169 / 8e-56 SAD1 SUPERSENSITIVE TO ABA AND DROUGHT 1, Small nuclear ribonucleoprotein family protein (.1)
AT4G30330 47 / 1e-07 Small nuclear ribonucleoprotein family protein (.1)
AT2G18740 46 / 4e-07 Small nuclear ribonucleoprotein family protein (.1.2)
AT1G21190 42 / 2e-05 Small nuclear ribonucleoprotein family protein (.1)
AT1G76860 41 / 2e-05 Small nuclear ribonucleoprotein family protein (.1)
AT3G14080 39 / 0.0003 Small nuclear ribonucleoprotein family protein (.1.2)
AT3G11500 37 / 0.001 Small nuclear ribonucleoprotein family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022810 179 / 1e-59 AT5G48870 167 / 8e-56 SUPERSENSITIVE TO ABA AND DROUGHT 1, Small nuclear ribonucleoprotein family protein (.1)
Lus10018034 46 / 2e-06 AT4G20990 248 / 1e-81 A. THALIANA ALPHA CARBONIC ANHYDRASE 4, alpha carbonic anhydrase 4 (.1)
Lus10042030 46 / 3e-06 AT4G20990 313 / 9e-107 A. THALIANA ALPHA CARBONIC ANHYDRASE 4, alpha carbonic anhydrase 4 (.1)
Lus10011293 41 / 4e-05 AT1G76860 175 / 8e-59 Small nuclear ribonucleoprotein family protein (.1)
Lus10040487 41 / 4e-05 AT1G76860 175 / 8e-59 Small nuclear ribonucleoprotein family protein (.1)
Lus10026326 41 / 4e-05 AT1G76860 176 / 4e-59 Small nuclear ribonucleoprotein family protein (.1)
Lus10042341 40 / 0.0001 AT1G76860 132 / 2e-41 Small nuclear ribonucleoprotein family protein (.1)
Lus10017019 38 / 0.0003 AT3G11500 150 / 2e-49 Small nuclear ribonucleoprotein family protein (.1)
Lus10021342 37 / 0.001 AT3G11500 152 / 3e-50 Small nuclear ribonucleoprotein family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G277900 175 / 6e-58 AT5G48870 162 / 5e-54 SUPERSENSITIVE TO ABA AND DROUGHT 1, Small nuclear ribonucleoprotein family protein (.1)
Potri.009G072500 175 / 6e-58 AT5G48870 162 / 5e-54 SUPERSENSITIVE TO ABA AND DROUGHT 1, Small nuclear ribonucleoprotein family protein (.1)
Potri.018G096200 50 / 8e-09 AT4G30330 166 / 3e-55 Small nuclear ribonucleoprotein family protein (.1)
Potri.006G174000 50 / 8e-09 AT4G30330 166 / 3e-55 Small nuclear ribonucleoprotein family protein (.1)
Potri.002G068800 41 / 3e-05 AT1G76860 175 / 1e-58 Small nuclear ribonucleoprotein family protein (.1)
Potri.005G191600 40 / 4e-05 AT1G76860 176 / 3e-59 Small nuclear ribonucleoprotein family protein (.1)
Potri.006G211100 37 / 0.0004 AT3G11500 153 / 2e-50 Small nuclear ribonucleoprotein family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0527 Sm-like PF01423 LSM LSM domain
Representative CDS sequence
>Lus10011877 pacid=23169259 polypeptide=Lus10011877 locus=Lus10011877.g ID=Lus10011877.BGIv1.0 annot-version=v1.0
ATGGAGAGCTACAAACAAAGCCCAATAACAAAATCACAAGATTCCCCGCCACGTTCGGCGAAAACTGCGTCGTATCACTGTAAGCCGTGGCCACCAAAAC
AAAGCCGAGTCCGTTCTGCAACTCCTCCTCTGCCGCGCTTCGGATTCTTCTTCTTCAGCTTGTTGCTTGCTCCCAGTGGAATCGCCATGGCTAACAACCC
TTCGCAGCTGCTTCCCTCAGAGCTGATTGATAGGTGCATAGGTTCGAAGATATGGGTGATAATGAAAGGAGACAAGGAGCTTGTGGGAACTCTTAGGGGA
TTCGACGTCTACGTCAACATGGTCCTCGAAGACGTCACAGAATATGAAATCACTGCTGAAGGTCGGAGGATAACGAAGCTTGACCAGATATTGCTCAATG
GAAACAACATCGCCATTTTGGTTCCTGGTGGTTCTCCTGATCCAGAATGA
AA sequence
>Lus10011877 pacid=23169259 polypeptide=Lus10011877 locus=Lus10011877.g ID=Lus10011877.BGIv1.0 annot-version=v1.0
MESYKQSPITKSQDSPPRSAKTASYHCKPWPPKQSRVRSATPPLPRFGFFFFSLLLAPSGIAMANNPSQLLPSELIDRCIGSKIWVIMKGDKELVGTLRG
FDVYVNMVLEDVTEYEITAEGRRITKLDQILLNGNNIAILVPGGSPDPE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G48870 SAD1 SUPERSENSITIVE TO ABA AND DROU... Lus10011877 0 1
AT5G38720 unknown protein Lus10023232 1.0 0.9082
AT3G07590 Small nuclear ribonucleoprotei... Lus10028022 2.4 0.8972
AT3G17300 EMB2786 unknown protein Lus10037835 5.5 0.9052
AT5G64680 unknown protein Lus10018951 5.9 0.8781
AT4G13720 Inosine triphosphate pyrophosp... Lus10011757 9.4 0.8738
AT1G31220 Formyl transferase (.1) Lus10013428 10.4 0.8668
AT5G18540 unknown protein Lus10033960 14.2 0.8325
AT4G21800 QQT2 quatre-quart2, P-loop containi... Lus10040022 14.4 0.8606
AT2G35736 unknown protein Lus10028935 17.5 0.8561
AT5G66240 Transducin/WD40 repeat-like su... Lus10017157 20.0 0.8282

Lus10011877 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.