Lus10012085 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G07475 142 / 5e-43 Cupredoxin superfamily protein (.1)
AT2G32300 96 / 2e-24 UCC1 uclacyanin 1 (.1)
AT3G60270 94 / 2e-24 Cupredoxin superfamily protein (.1)
AT5G53870 89 / 5e-21 AtENODL1 early nodulin-like protein 1 (.1)
AT2G25060 84 / 2e-20 AtENODL14 early nodulin-like protein 14 (.1)
AT4G31840 82 / 6e-20 AtENODL15 early nodulin-like protein 15 (.1)
AT2G44790 81 / 3e-19 UCC2 uclacyanin 2 (.1)
AT1G72230 80 / 6e-19 Cupredoxin superfamily protein (.1)
AT3G60280 80 / 1e-18 UCC3 uclacyanin 3 (.1)
AT3G20570 79 / 2e-18 AtENODL9 early nodulin-like protein 9 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007401 217 / 4e-69 AT1G51690 460 / 7e-159 protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform (.1.2.3)
Lus10008720 102 / 1e-27 AT1G72230 140 / 2e-42 Cupredoxin superfamily protein (.1)
Lus10020944 100 / 7e-27 AT1G72230 141 / 1e-42 Cupredoxin superfamily protein (.1)
Lus10027143 100 / 3e-26 AT2G32300 137 / 9e-40 uclacyanin 1 (.1)
Lus10012165 88 / 6e-22 AT5G07475 89 / 1e-22 Cupredoxin superfamily protein (.1)
Lus10007582 92 / 7e-22 AT4G35110 120 / 2e-29 Arabidopsis phospholipase-like protein (PEARLI 4) family (.1), Arabidopsis phospholipase-like protein (PEARLI 4) family (.2), Arabidopsis phospholipase-like protein (PEARLI 4) family (.3), Arabidopsis phospholipase-like protein (PEARLI 4) family (.4)
Lus10026064 81 / 2e-19 AT5G15350 113 / 4e-32 early nodulin-like protein 17 (.1)
Lus10002614 79 / 4e-19 AT2G32300 100 / 1e-26 uclacyanin 1 (.1)
Lus10011433 80 / 8e-19 AT1G79800 124 / 4e-36 early nodulin-like protein 7 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G150300 171 / 9e-55 AT5G07475 178 / 2e-57 Cupredoxin superfamily protein (.1)
Potri.001G080700 168 / 1e-53 AT5G07475 164 / 1e-51 Cupredoxin superfamily protein (.1)
Potri.014G049600 99 / 2e-26 AT3G60270 111 / 8e-31 Cupredoxin superfamily protein (.1)
Potri.007G120200 97 / 4e-25 AT2G32300 118 / 3e-32 uclacyanin 1 (.1)
Potri.002G101300 89 / 2e-22 AT1G72230 131 / 6e-39 Cupredoxin superfamily protein (.1)
Potri.002G101200 88 / 2e-21 AT1G72230 129 / 2e-37 Cupredoxin superfamily protein (.1)
Potri.009G136200 81 / 2e-19 AT5G26330 88 / 4e-22 Cupredoxin superfamily protein (.1)
Potri.006G264600 80 / 5e-19 AT2G25060 184 / 9e-60 early nodulin-like protein 14 (.1)
Potri.003G183300 80 / 6e-19 AT5G15350 123 / 1e-35 early nodulin-like protein 17 (.1)
Potri.002G161300 79 / 1e-18 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10012085 pacid=23146017 polypeptide=Lus10012085 locus=Lus10012085.g ID=Lus10012085.BGIv1.0 annot-version=v1.0
ATGGCTGACCCGAATTCGCTTTGTTTTAATCTCCTAGCCGCCGCCGTTGTTCTCAGCCTAGCCTTCTCATCTTGCGGCGCCACAACTTACACGGTCGGAG
ACAATTCAGGTTGGGACATAAGCAGTGATCTCGACAGTTGGGCTCAGGATAAAACCTTCTACGTCGGAGATGCTCTCTTGTTTCAGTACAAATCCTCAGA
GACAGTAGAAGAAGTGAACAAAGCATCTTTCGACGGCTGCAATACGACGGACGTAATGAAATCGTTCAACGACGGGAATACGACGGTGGAATTGGACAGT
GGTGGACCCTGGTATTTCATCTGTGGGAACAAGTTGTACTGCTTTGGAGGGATGAAGCTCCAGGTGGACGTCAAAGGTAATCAGACTGTTGCAGATTCAC
CAATTGGTTCCCCTGAGGGGCAGCCTGCAAACCCTTCTTCCAAGACCGACTTCCCCTCTTCTTCAGCTTTTGTTCATCGCAGCACTGAGACTCTTGTGAT
CATTGTTGGTGGAAACCCAAGTTGA
AA sequence
>Lus10012085 pacid=23146017 polypeptide=Lus10012085 locus=Lus10012085.g ID=Lus10012085.BGIv1.0 annot-version=v1.0
MADPNSLCFNLLAAAVVLSLAFSSCGATTYTVGDNSGWDISSDLDSWAQDKTFYVGDALLFQYKSSETVEEVNKASFDGCNTTDVMKSFNDGNTTVELDS
GGPWYFICGNKLYCFGGMKLQVDVKGNQTVADSPIGSPEGQPANPSSKTDFPSSSAFVHRSTETLVIIVGGNPS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G07475 Cupredoxin superfamily protein... Lus10012085 0 1
AT4G24130 Protein of unknown function, D... Lus10017330 1.4 0.9831
Lus10034812 2.0 0.9811
AT4G02830 unknown protein Lus10042573 2.2 0.9754
AT1G64000 WRKY ATWRKY56, WRKY5... WRKY DNA-binding protein 56 (.... Lus10007906 2.6 0.9740
Lus10018643 3.0 0.9759
AT1G49960 Xanthine/uracil permease famil... Lus10033773 3.5 0.9748
AT2G36290 alpha/beta-Hydrolases superfam... Lus10028860 3.6 0.9650
AT5G55180 O-Glycosyl hydrolases family 1... Lus10040600 4.0 0.9586
AT1G03700 Uncharacterised protein family... Lus10011179 4.5 0.9706
AT5G41040 HXXXD-type acyl-transferase fa... Lus10032554 4.5 0.9758

Lus10012085 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.