Lus10012165 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G26330 87 / 1e-21 Cupredoxin superfamily protein (.1)
AT2G31050 87 / 1e-21 Cupredoxin superfamily protein (.1)
AT5G07475 85 / 8e-21 Cupredoxin superfamily protein (.1)
AT3G17675 82 / 9e-21 Cupredoxin superfamily protein (.1)
AT2G26720 83 / 5e-20 Cupredoxin superfamily protein (.1)
AT1G17800 76 / 1e-17 AtENODL22 early nodulin-like protein 22 (.1)
AT2G32300 75 / 2e-16 UCC1 uclacyanin 1 (.1)
AT3G60270 73 / 2e-16 Cupredoxin superfamily protein (.1)
AT2G27035 72 / 4e-16 AtENODL20 early nodulin-like protein 20 (.1)
AT1G72230 70 / 3e-15 Cupredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007582 286 / 8e-94 AT4G35110 120 / 2e-29 Arabidopsis phospholipase-like protein (PEARLI 4) family (.1), Arabidopsis phospholipase-like protein (PEARLI 4) family (.2), Arabidopsis phospholipase-like protein (PEARLI 4) family (.3), Arabidopsis phospholipase-like protein (PEARLI 4) family (.4)
Lus10010533 96 / 8e-25 AT5G26330 174 / 1e-55 Cupredoxin superfamily protein (.1)
Lus10041849 90 / 2e-23 AT2G02850 130 / 5e-40 plantacyanin (.1)
Lus10012085 90 / 9e-23 AT5G07475 142 / 4e-43 Cupredoxin superfamily protein (.1)
Lus10002614 84 / 5e-21 AT2G32300 100 / 1e-26 uclacyanin 1 (.1)
Lus10007026 85 / 8e-21 AT2G32300 96 / 4e-25 uclacyanin 1 (.1)
Lus10041850 81 / 6e-20 AT2G02850 121 / 1e-36 plantacyanin (.1)
Lus10041211 82 / 2e-19 AT5G26330 167 / 6e-53 Cupredoxin superfamily protein (.1)
Lus10026064 82 / 2e-19 AT5G15350 113 / 4e-32 early nodulin-like protein 17 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G136200 134 / 5e-40 AT5G26330 88 / 4e-22 Cupredoxin superfamily protein (.1)
Potri.010G089900 93 / 7e-24 AT5G26330 187 / 7e-61 Cupredoxin superfamily protein (.1)
Potri.001G080700 89 / 2e-22 AT5G07475 164 / 1e-51 Cupredoxin superfamily protein (.1)
Potri.013G061300 88 / 3e-22 AT3G17675 102 / 1e-28 Cupredoxin superfamily protein (.1)
Potri.002G161300 87 / 1e-21 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1)
Potri.008G151000 87 / 1e-21 AT5G26330 183 / 2e-59 Cupredoxin superfamily protein (.1)
Potri.003G150300 86 / 5e-21 AT5G07475 178 / 2e-57 Cupredoxin superfamily protein (.1)
Potri.006G259101 84 / 1e-20 AT5G26330 142 / 2e-43 Cupredoxin superfamily protein (.1)
Potri.006G259000 84 / 2e-20 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1)
Potri.003G047300 84 / 5e-20 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10012165 pacid=23154917 polypeptide=Lus10012165 locus=Lus10012165.g ID=Lus10012165.BGIv1.0 annot-version=v1.0
ATGGCGATGGTGGTGATCAATTACAGCTTGTTTCTGATTTCCCTTTTGGCCGTGATTGTCATGATCAATGGCGTCGTGTTCACAGCTCGTGGTGAAGTGT
TCAAGGTTGGCGATGAAAGTGGTTGGAATATGCAGGTCAACTACGGGTCCTGGTCGGAGAAGCACAACTTCACCGTCGGCGACATACTCGAGTTCAAGTA
CTCGAAATCGGACCACAACGTGTACGAGGTGACGAGGGAAGTGTTTCAAACTTGCAACACAAGCCTCGGAGACGTGATGGCCAAGTATCAAAGTGGGAAT
GATGAAATAGAGCTTAGAGAGGGCAAGAAATATTGGTTCATCTGCGAAATTGATGGCCATTGCCTTGGTGGGATGAGATTGGCTATTGGAGTTGAGAACC
AGACTGTCGCCGCCGCTGCCGGCAATGACGGGAGCGGGAGCGGCGACCCTTCTTCGGGTTATAAGGATGTGTACAACTTTGGGAGATGTTGTACCTCTTT
TGTTCACTTGGTATTTGTACTCATTTGCATTTGGAAGTGGTGA
AA sequence
>Lus10012165 pacid=23154917 polypeptide=Lus10012165 locus=Lus10012165.g ID=Lus10012165.BGIv1.0 annot-version=v1.0
MAMVVINYSLFLISLLAVIVMINGVVFTARGEVFKVGDESGWNMQVNYGSWSEKHNFTVGDILEFKYSKSDHNVYEVTREVFQTCNTSLGDVMAKYQSGN
DEIELREGKKYWFICEIDGHCLGGMRLAIGVENQTVAAAAGNDGSGSGDPSSGYKDVYNFGRCCTSFVHLVFVLICIWKW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G07475 Cupredoxin superfamily protein... Lus10012165 0 1
AT4G26210 Mitochondrial ATP synthase sub... Lus10040544 2.8 0.8061
AT2G38080 ATLMCO4, IRX12,... LACCASE 4, IRREGULAR XYLEM 12,... Lus10032894 7.2 0.8432
Lus10026494 18.1 0.8315
AT4G18700 ATWL4, CIPK12, ... SNF1-RELATED PROTEIN KINASE 3.... Lus10007284 20.7 0.8163
AT2G17570 Undecaprenyl pyrophosphate syn... Lus10032757 24.0 0.8093
AT4G34490 ATCAP1 cyclase associated protein 1 (... Lus10040460 25.7 0.7992
AT5G42660 Protein of unknown function (D... Lus10032311 27.5 0.8026
AT5G01360 TBL3 TRICHOME BIREFRINGENCE-LIKE 3,... Lus10027813 29.0 0.8225
AT5G40630 Ubiquitin-like superfamily pro... Lus10032107 29.1 0.8048
AT1G71070 Core-2/I-branching beta-1,6-N-... Lus10033379 32.4 0.8179

Lus10012165 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.