Lus10012263 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G20580 214 / 6e-73 Small nuclear ribonucleoprotein family protein (.1)
AT1G76300 206 / 6e-70 SMD3 snRNP core protein SMD3 (.1)
AT5G27720 60 / 2e-12 LSM4, EMB1644 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1)
AT4G02840 51 / 4e-09 Small nuclear ribonucleoprotein family protein (.1.2)
AT3G07590 47 / 1e-07 Small nuclear ribonucleoprotein family protein (.1.2)
AT1G20600 40 / 0.0001 B3 AP2/B3-like transcriptional factor family protein (.1)
AT1G03330 38 / 0.0003 Small nuclear ribonucleoprotein family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016013 237 / 5e-82 AT1G20580 219 / 3e-75 Small nuclear ribonucleoprotein family protein (.1)
Lus10013227 237 / 5e-82 AT1G20580 214 / 2e-73 Small nuclear ribonucleoprotein family protein (.1)
Lus10030747 237 / 5e-82 AT1G20580 214 / 2e-73 Small nuclear ribonucleoprotein family protein (.1)
Lus10029426 62 / 7e-12 AT5G27720 190 / 2e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1)
Lus10004221 61 / 1e-11 AT5G27720 182 / 2e-57 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1)
Lus10028022 49 / 4e-08 AT3G07590 181 / 1e-60 Small nuclear ribonucleoprotein family protein (.1.2)
Lus10003727 49 / 1e-07 AT3G07590 180 / 1e-58 Small nuclear ribonucleoprotein family protein (.1.2)
Lus10025186 46 / 3e-07 AT3G07590 169 / 6e-56 Small nuclear ribonucleoprotein family protein (.1.2)
Lus10016068 46 / 3e-07 AT3G07590 169 / 6e-56 Small nuclear ribonucleoprotein family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G010200 232 / 4e-80 AT1G20580 214 / 5e-73 Small nuclear ribonucleoprotein family protein (.1)
Potri.005G251100 229 / 3e-79 AT1G20580 211 / 6e-72 Small nuclear ribonucleoprotein family protein (.1)
Potri.002G205700 60 / 3e-12 AT5G27720 179 / 5e-59 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1)
Potri.014G130700 59 / 9e-12 AT5G27720 176 / 7e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1)
Potri.002G054800 52 / 3e-09 AT3G07590 183 / 1e-61 Small nuclear ribonucleoprotein family protein (.1.2)
Potri.005G207900 44 / 1e-06 AT4G02840 152 / 3e-49 Small nuclear ribonucleoprotein family protein (.1.2)
Potri.004G219000 37 / 0.0004 AT1G03330 184 / 1e-62 Small nuclear ribonucleoprotein family protein (.1)
Potri.003G014900 37 / 0.0004 AT1G03330 184 / 1e-62 Small nuclear ribonucleoprotein family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0527 Sm-like PF01423 LSM LSM domain
Representative CDS sequence
>Lus10012263 pacid=23172718 polypeptide=Lus10012263 locus=Lus10012263.g ID=Lus10012263.BGIv1.0 annot-version=v1.0
ATGAGCAGAAGCTTGGGAATACCGGTAAAGCTACTCCACGAAGCCTCCGGCCACATCGTGACGGTGGAGCTTAAAAGCGGCGAGCTCTACAGAGGGAGCA
TGTTGGAGTGCGAAGACAACTGGAATTGCCAGCTCGAGAACATTACTTACACTGCTAAGGATGGAAAGATTTCACAGCTTGAGCATGTTTTTATCAGAGG
CAGCAAAGTCAGGTTTATGGTGATACCAGATATGCTAAAGAATGCCCCCATGTTTAAGCGTCTAGATGCTCGAATCAAGGGCAAGAGCGCCTCACTTGGA
GTGGGGAGGGGAAGATCTGTTGCCATGCGTGCTAAAGCACAGGCTGCTACAGGGCGCGGAGGACCTGGAAGGGGAGCAGTACCACCTGTTAGGAGATAA
AA sequence
>Lus10012263 pacid=23172718 polypeptide=Lus10012263 locus=Lus10012263.g ID=Lus10012263.BGIv1.0 annot-version=v1.0
MSRSLGIPVKLLHEASGHIVTVELKSGELYRGSMLECEDNWNCQLENITYTAKDGKISQLEHVFIRGSKVRFMVIPDMLKNAPMFKRLDARIKGKSASLG
VGRGRSVAMRAKAQAATGRGGPGRGAVPPVRR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G20580 Small nuclear ribonucleoprotei... Lus10012263 0 1
AT4G22320 unknown protein Lus10043179 3.7 0.8814
AT1G20580 Small nuclear ribonucleoprotei... Lus10013227 3.9 0.8729
AT3G27360 Histone superfamily protein (.... Lus10031252 5.1 0.8919
AT3G03920 H/ACA ribonucleoprotein comple... Lus10020289 9.2 0.8675
AT3G53430 Ribosomal protein L11 family p... Lus10015086 14.5 0.8445
AT5G05610 Alfin AL1 alfin-like 1 (.1.2) Lus10014843 14.7 0.8048
AT5G49170 unknown protein Lus10022872 15.1 0.8473
AT2G28740 HIS4 histone H4 (.1) Lus10025964 23.4 0.8673
AT4G15000 Ribosomal L27e protein family ... Lus10039017 23.5 0.8205
AT1G20580 Small nuclear ribonucleoprotei... Lus10030747 24.3 0.7858

Lus10012263 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.