Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18210 100 / 1e-26 ATPUP10 purine permease 10 (.1) AT4G18220 96 / 3e-25 Drug/metabolite transporter superfamily protein (.1) AT1G44750 96 / 8e-25 ATPUP11 purine permease 11 (.1.2.3) AT4G18197 88 / 6e-22 PEX17, ATPUP7, AT4G18200 PEROXIN 17, ARABIDOPSIS THALIANA PURINE PERMEASE 7, purine permease 7 (.1) AT4G08700 74 / 7e-17 ATPUP13 Drug/metabolite transporter superfamily protein (.1) AT1G19770 72 / 2e-16 ATPUP14 purine permease 14 (.1) AT4G18195 71 / 1e-15 ATPUP8, AT4G18200 ARABIDOPSIS THALIANA PURINE PERMEASE 8, purine permease 8 (.1) AT4G18205 70 / 2e-15 AT4G18200 Nucleotide-sugar transporter family protein (.1) AT1G47603 69 / 6e-15 ATPUP19 purine permease 19 (.1) AT5G41160 67 / 1e-14 ATPUP12 ARABIDOPSIS THALIANA PURINE PERMEASE 12, purine permease 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040118 [exp] 158 / 1e-48 AT4G18210 336 / 2e-113 purine permease 10 (.1) Lus10030927 [exp] 157 / 3e-48 AT4G18210 336 / 1e-113 purine permease 10 (.1) Lus10042836 [exp] 94 / 4e-26 AT4G18220 155 / 2e-47 Drug/metabolite transporter superfamily protein (.1) Lus10043350 [exp] 96 / 9e-25 AT1G44750 456 / 8e-161 purine permease 11 (.1.2.3) Lus10028132 [exp] 96 / 2e-24 AT4G18220 361 / 4e-123 Drug/metabolite transporter superfamily protein (.1) Lus10019503 [exp] 91 / 6e-23 AT1G44750 452 / 1e-159 purine permease 11 (.1.2.3) Lus10008689 [exp] 91 / 9e-23 AT4G18210 382 / 3e-131 purine permease 10 (.1) Lus10026130 [exp] 90 / 1e-22 AT4G18210 382 / 2e-131 purine permease 10 (.1) Lus10023317 [exp] 82 / 3e-21 AT4G18210 150 / 3e-45 purine permease 10 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G147600 [exp] 115 / 2e-32 AT4G18210 315 / 7e-105 purine permease 10 (.1) Potri.001G352100 [exp] 100 / 1e-26 AT4G18210 398 / 1e-137 purine permease 10 (.1) Potri.001G352200 [exp] 100 / 1e-26 AT4G18220 315 / 1e-105 Drug/metabolite transporter superfamily protein (.1) Potri.014G043900 [exp] 86 / 3e-21 AT1G44750 434 / 2e-152 purine permease 11 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0184 [flax] [poplar] DMT PF03151 [flax] [poplar] TPT Triose-phosphate Transporter family
Representative CDS sequence Show only first row Show all	>Lus10012606 pacid=23161349 polypeptide=Lus10012606 locus=Lus10012606.g ID=Lus10012606.BGIv1.0 annot-version=v1.0 ATGGCGGGATGCGTGGTAGGGTTATTCGCTAGTGGGGAGTTGAAGGGGTTGGAAGATGAGATGAAGGGTTACAGGCAGGGGAAAGCGGCGTACTTGTTGA ATCTGATTAGGATGGCGATTGGGTGGTACGTTTCGTCATTGGGGCTTTTAGGGTTGGTTTACGAGGTGTCGTTGTTTTTTCCGAATGTGATCGATATTCT GGCTCTGCCAGAAGTTCCGATTCTGGCGGTGGTGATTTTCGGTGATAAGATGGATGGGGTGAAGGCGGTGGCGATGGTGGGCCATTAA
AA sequence Show only first row Show all	>Lus10012606 pacid=23161349 polypeptide=Lus10012606 locus=Lus10012606.g ID=Lus10012606.BGIv1.0 annot-version=v1.0 MAGCVVGLFASGELKGLEDEMKGYRQGKAAYLLNLIRMAIGWYVSSLGLLGLVYEVSLFFPNVIDILALPEVPILAVVIFGDKMDGVKAVAMVGH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G44750		ATPUP11	purine permease 11 (.1.2.3)		Lus10012606 [exp]	0	1
AT3G24530			AAA-type ATPase family protein...		Lus10005293 [exp]	6.1	0.8691
AT2G30860		GLUTTR, ATGSTF7...	glutathione S-transferase PHI ...		Lus10020736 [exp]	6.3	0.8615
AT1G60030		ATNAT7	ARABIDOPSIS NUCLEOBASE-ASCORBA...		Lus10005717 [exp]	9.2	0.8394
AT2G30860		GLUTTR, ATGSTF7...	glutathione S-transferase PHI ...		Lus10029816 [exp]	9.9	0.8607
AT5G47090			unknown protein		Lus10021704 [exp]	10.0	0.8516
AT5G39960			GTP binding;GTP binding (.1)		Lus10033794 [exp]	12.0	0.8207
AT4G25440	C3HZnF	ZFWD1	zinc finger WD40 repeat protei...		Lus10000559 [exp]	14.4	0.8525
AT3G56400	WRKY	ATWRKY70, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10025133 [exp]	14.5	0.8249
AT3G56400	WRKY	ATWRKY70, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10025216 [exp]	15.1	0.8227
AT3G24490	Trihelix		Alcohol dehydrogenase transcri...		Lus10019568 [exp]	15.3	0.7621

Compare expression of checked genes

Lus10012606 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.