Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G37160 66 / 3e-14 SKS15 SKU5 similar 15 (.1) AT1G55570 65 / 5e-14 SKS12 SKU5 similar 12 (.1) AT2G23630 62 / 6e-13 SKS16 SKU5 similar 16 (.1) AT3G13400 61 / 2e-12 SKS13 SKU5 similar 13 (.1) AT1G41830 57 / 2e-11 SKS6 SKU5 SIMILAR 6, SKU5-similar 6 (.1) AT3G13390 57 / 4e-11 SKS11 SKU5 similar 11 (.1) AT5G66920 56 / 9e-11 SKS17 SKU5 similar 17 (.1) AT1G55560 55 / 1e-10 SKS14 SKU5 similar 14 (.1) AT5G48450 54 / 5e-10 SKS3 SKU5 similar 3 (.1) AT1G75790 53 / 6e-10 SKS18 SKU5 similar 18 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017262 [exp] 96 / 6e-25 AT1G75790 518 / 0.0 SKU5 similar 18 (.1) Lus10010337 [exp] 61 / 1e-12 AT1G55570 803 / 0.0 SKU5 similar 12 (.1) Lus10010338 [exp] 59 / 6e-12 AT1G55570 815 / 0.0 SKU5 similar 12 (.1) Lus10036492 [exp] 59 / 8e-12 AT3G13400 808 / 0.0 SKU5 similar 13 (.1) Lus10010358 [exp] 59 / 8e-12 AT3G13400 807 / 0.0 SKU5 similar 13 (.1) Lus10021864 [exp] 57 / 3e-11 AT1G55570 814 / 0.0 SKU5 similar 12 (.1) Lus10019642 [exp] 55 / 1e-10 AT4G37160 751 / 0.0 SKU5 similar 15 (.1) Lus10030045 [exp] 55 / 2e-10 AT1G76160 796 / 0.0 SKU5 similar 5 (.1) Lus10035282 [exp] 54 / 2e-10 AT1G76160 798 / 0.0 SKU5 similar 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G021000 [exp] 72 / 2e-16 AT1G75790 670 / 0.0 SKU5 similar 18 (.1) Potri.001G000500 [exp] 65 / 4e-14 AT1G55570 853 / 0.0 SKU5 similar 12 (.1) Potri.007G038200 [exp] 61 / 1e-12 AT4G37160 771 / 0.0 SKU5 similar 15 (.1) Potri.001G000600 [exp] 60 / 3e-12 AT1G55570 850 / 0.0 SKU5 similar 12 (.1) Potri.003G224100 [exp] 58 / 1e-11 AT1G55570 855 / 0.0 SKU5 similar 12 (.1) Potri.014G177700 [exp] 57 / 3e-11 AT5G48450 885 / 0.0 SKU5 similar 3 (.1) Potri.005G247700 [exp] 56 / 7e-11 AT1G76160 878 / 0.0 SKU5 similar 5 (.1) Potri.002G013700 [exp] 56 / 7e-11 AT1G76160 902 / 0.0 SKU5 similar 5 (.1) Potri.004G180500 [exp] 56 / 9e-11 AT1G76160 880 / 0.0 SKU5 similar 5 (.1) Potri.007G038300 [exp] 56 / 9e-11 AT5G66920 822 / 0.0 SKU5 similar 17 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [flax] [poplar] CU_oxidase PF07732 [flax] [poplar] Cu-oxidase_3 Multicopper oxidase
Representative CDS sequence Show only first row Show all	>Lus10013557 pacid=23168742 polypeptide=Lus10013557 locus=Lus10013557.g ID=Lus10013557.BGIv1.0 annot-version=v1.0 ATGATGGTACAAGCCGAATCAGGCTCGGTGTATTACGACTGGAACGTCTCTCTTTCGACTCGTGCTCCTCTTGATGTCGAGAAGCAAGTGATTGTGATCA ACGATCAATTCCCGGGACCGTTGGTGAACGCCACCACTAACGACGTGGTTAATGTCAATGTCTACAACAACTTGGCCGAACCGTTCTTGATCACATGGAA CGGGGTGTAA
AA sequence Show only first row Show all	>Lus10013557 pacid=23168742 polypeptide=Lus10013557 locus=Lus10013557.g ID=Lus10013557.BGIv1.0 annot-version=v1.0 MMVQAESGSVYYDWNVSLSTRAPLDVEKQVIVINDQFPGPLVNATTNDVVNVNVYNNLAEPFLITWNGV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G75790		SKS18	SKU5 similar 18 (.1)		Lus10013557 [exp]	0	1

Compare expression of checked genes

Lus10013557 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.