Lus10013835 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G42005 149 / 4e-44 Transmembrane amino acid transporter family protein (.1)
AT4G38250 148 / 8e-44 Transmembrane amino acid transporter family protein (.1)
AT5G65990 145 / 2e-42 Transmembrane amino acid transporter family protein (.1)
AT3G11900 71 / 4e-15 ANT1 aromatic and neutral transporter 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026549 211 / 4e-68 AT2G42005 548 / 0.0 Transmembrane amino acid transporter family protein (.1)
Lus10022995 169 / 7e-52 AT2G42005 580 / 0.0 Transmembrane amino acid transporter family protein (.1)
Lus10001390 168 / 2e-51 AT2G42005 581 / 0.0 Transmembrane amino acid transporter family protein (.1)
Lus10021089 71 / 4e-15 AT3G11900 501 / 2e-176 aromatic and neutral transporter 1 (.1)
Lus10017224 71 / 6e-15 AT3G11900 502 / 3e-177 aromatic and neutral transporter 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G102300 155 / 1e-46 AT4G38250 539 / 0.0 Transmembrane amino acid transporter family protein (.1)
Potri.009G167900 155 / 2e-46 AT4G38250 583 / 0.0 Transmembrane amino acid transporter family protein (.1)
Potri.004G206800 150 / 2e-44 AT2G42005 592 / 0.0 Transmembrane amino acid transporter family protein (.1)
Potri.016G064500 73 / 7e-16 AT3G11900 521 / 0.0 aromatic and neutral transporter 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0062 APC PF01490 Aa_trans Transmembrane amino acid transporter protein
Representative CDS sequence
>Lus10013835 pacid=23159453 polypeptide=Lus10013835 locus=Lus10013835.g ID=Lus10013835.BGIv1.0 annot-version=v1.0
ATGGGAGTTGTGATGGTCGAAGATGTCTCGATTATATCACAAAACGACACCGTCCAAGAAGTCAAGGCATTCGGGAGTCTATTGGTATTCTTCTACGGAA
TGGGAGTGGCCGTCTACGCATTCGAAGGAATCGGAATGGTCCTGCCTCTGGAATCGGAAGGCAAACACAAGGACAAATTCGAGAGGAATTTGGCCTTTGC
GATGGGATTCATGTCGGCTATCTACGGAGCGTTTGGCGCGTTAGGTTACCTTGCGTTTGGTAGCGAGACTAAAGACACTATAACTGCGAATCTCGGAGTC
AGGTCGGTTAGTACATTGGTGCATATCGGATTGTGTATAAACCTGTTCTTTACATTTCCGTTGATGATGAACCCGGTTTACGAGATCGTGGAGAGGCAGT
TCTGA
AA sequence
>Lus10013835 pacid=23159453 polypeptide=Lus10013835 locus=Lus10013835.g ID=Lus10013835.BGIv1.0 annot-version=v1.0
MGVVMVEDVSIISQNDTVQEVKAFGSLLVFFYGMGVAVYAFEGIGMVLPLESEGKHKDKFERNLAFAMGFMSAIYGAFGALGYLAFGSETKDTITANLGV
RSVSTLVHIGLCINLFFTFPLMMNPVYEIVERQF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G42005 Transmembrane amino acid trans... Lus10013835 0 1
Lus10034388 1.4 0.9408
AT5G48290 Heavy metal transport/detoxifi... Lus10025182 2.0 0.9271
AT5G18470 Curculin-like (mannose-binding... Lus10004765 10.9 0.8280
AT5G03170 ATFLA11, FLA11,... ARABIDOPSIS FASCICLIN-LIKE ARA... Lus10002984 14.3 0.8485
AT3G61230 LIM PLIM2c PLIM2c, GATA type zinc finger ... Lus10020687 14.9 0.8951
AT4G32480 Protein of unknown function (D... Lus10041046 17.3 0.8449
AT3G56290 unknown protein Lus10029051 20.9 0.8730
AT5G28540 BIP1 heat shock protein 70 (Hsp 70)... Lus10015483 20.9 0.7665
AT1G79510 Uncharacterized conserved prot... Lus10001766 28.3 0.8533
AT1G63270 ABCI1, ATNAP10 ATP-binding cassette I1, non-i... Lus10040034 31.4 0.7018

Lus10013835 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.