Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G23240 102 / 4e-28 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1) AT5G47220 96 / 2e-25 AP2_ERF ATERF-2, ERF2, ATERF2 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1) AT4G17500 96 / 3e-25 AP2_ERF ATERF-1, AtERF1 ethylene responsive element binding factor 1 (.1) AT2G44840 95 / 5e-25 AP2_ERF ATERF13, EREBP ethylene-responsive element binding factor 13 (.1) AT5G51190 91 / 1e-23 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G47230 92 / 2e-23 AP2_ERF ATERF5, ATERF-5, ERF5 ETHYLENE RESPONSIVE ELEMENT BINDING FACTOR- 5, ethylene responsive element binding factor 5 (.1) AT4G17490 89 / 1e-22 AP2_ERF ERF-6-6, ATERF6 ethylene responsive element binding factor 6 (.1) AT3G23220 85 / 4e-22 AP2_ERF ESE1 ethylene and salt inducible 1, Integrase-type DNA-binding superfamily protein (.1) AT5G07580 86 / 3e-21 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT5G61590 84 / 3e-21 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005285 [exp] 160 / 2e-51 AT3G23240 120 / 1e-34 ethylene response factor 1 (.1) Lus10025430 [exp] 127 / 2e-38 AT3G23240 132 / 6e-39 ethylene response factor 1 (.1) Lus10016211 [exp] 96 / 1e-25 AT2G44840 158 / 2e-48 ethylene-responsive element binding factor 13 (.1) Lus10032499 [exp] 96 / 3e-25 AT5G51190 186 / 8e-59 Integrase-type DNA-binding superfamily protein (.1) Lus10021193 [exp] 94 / 8e-25 AT3G23240 209 / 2e-68 ethylene response factor 1 (.1) Lus10006579 [exp] 94 / 1e-24 AT3G23240 211 / 4e-69 ethylene response factor 1 (.1) Lus10022015 [exp] 93 / 3e-24 AT3G23240 176 / 1e-55 ethylene response factor 1 (.1) Lus10029333 [exp] 91 / 6e-24 AT2G44840 147 / 1e-44 ethylene-responsive element binding factor 13 (.1) Lus10042996 [exp] 93 / 7e-24 AT5G51190 189 / 6e-60 Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G061700 [exp] 127 / 2e-38 AT3G23240 111 / 1e-30 ethylene response factor 1 (.1) Potri.004G051700 [exp] 125 / 1e-37 AT5G47220 111 / 1e-30 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1) Potri.013G045200 [exp] 106 / 1e-29 AT3G23240 167 / 5e-52 ethylene response factor 1 (.1) Potri.019G014409 [exp] 98 / 3e-26 AT3G23240 161 / 1e-49 ethylene response factor 1 (.1) Potri.008G166200 [exp] 97 / 4e-26 AT3G23240 202 / 1e-65 ethylene response factor 1 (.1) Potri.010G072300 [exp] 95 / 3e-25 AT3G23240 201 / 2e-65 ethylene response factor 1 (.1) Potri.001G154200 [exp] 96 / 1e-24 AT4G17490 159 / 2e-46 ethylene responsive element binding factor 6 (.1) Potri.003G080600 [exp] 96 / 1e-24 AT4G17490 159 / 3e-46 ethylene responsive element binding factor 6 (.1) Potri.003G150800 [exp] 95 / 1e-24 AT5G51190 185 / 7e-58 Integrase-type DNA-binding superfamily protein (.1) Potri.001G079800 [exp] 95 / 1e-24 AT5G51190 186 / 2e-58 Integrase-type DNA-binding superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10013959 pacid=23170129 polypeptide=Lus10013959 locus=Lus10013959.g ID=Lus10013959.BGIv1.0 annot-version=v1.0 ATGAGTTCATCACAGTTGCCTTTCAACGAGAATGATTCTCAGGATATGACGATTCTCCACATGATGAACCAACCCACCAACCCCGAATTCAACCCGGTTC TGCAGCCGTCTAGCCGTGTCATAGCGAAACGACTCCACTACAGAGGCGTCCGTCGCCGGCCGTGGGGGAAATACGCCGCGGAAATACGCGATTCTTCCCG GCGCGGTGCGAGGGTCTGGCTCGGAACGTTCGAGACAGCCGAAGATGCGGCGGTTGCTTACGATCGCGCCGCCTTCCGAATGCGGGGATCCAGGGCAGTC CTCAATTTCCCGCCGGTGGTCGGTGATCAGCCAGGGGAGAAAGCCAGCTCGGCGGCGGGGGAGTGA
AA sequence Show only first row Show all	>Lus10013959 pacid=23170129 polypeptide=Lus10013959 locus=Lus10013959.g ID=Lus10013959.BGIv1.0 annot-version=v1.0 MSSSQLPFNENDSQDMTILHMMNQPTNPEFNPVLQPSSRVIAKRLHYRGVRRRPWGKYAAEIRDSSRRGARVWLGTFETAEDAAVAYDRAAFRMRGSRAV LNFPPVVGDQPGEKASSAAGE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G23240	AP2_ERF	ERF1, ATERF1	ethylene response factor 1 (.1...		Lus10013959 [exp]	0	1
AT5G06130			chaperone protein dnaJ-related...		Lus10014223 [exp]	2.0	0.8780
AT5G54940			Translation initiation factor ...		Lus10021532 [exp]	8.0	0.8827
AT5G17540			HXXXD-type acyl-transferase fa...		Lus10005659 [exp]	20.9	0.8499
AT1G11260		ATSTP1, STP1	sugar transporter 1 (.1)		Lus10018422 [exp]	22.1	0.8511
AT1G67910			unknown protein		Lus10034901 [exp]	35.5	0.8205
AT4G35770		ATSEN1, DIN1, S...	SENESCENCE ASSOCIATED GENE 1, ...		Lus10041843 [exp]	35.7	0.8485
AT4G11170			Disease resistance protein (TI...		Lus10006732 [exp]	37.5	0.7856
AT5G27830			unknown protein		Lus10029881 [exp]	38.5	0.8450
AT1G15190			Fasciclin-like arabinogalactan...		Lus10023801 [exp]	40.6	0.7852
AT5G38200			Class I glutamine amidotransfe...		Lus10035996 [exp]	42.2	0.8157

Compare expression of checked genes

Lus10013959 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.