Lus10014356 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G15350 96 / 2e-25 AtENODL17 early nodulin-like protein 17 (.1)
AT4G12880 92 / 6e-24 AtENODL19 early nodulin-like protein 19 (.1.2)
AT3G01070 90 / 5e-23 AtENODL16 early nodulin-like protein 16 (.1)
AT2G27035 81 / 1e-19 AtENODL20 early nodulin-like protein 20 (.1)
AT3G17675 79 / 3e-19 Cupredoxin superfamily protein (.1)
AT3G27200 71 / 1e-15 Cupredoxin superfamily protein (.1)
AT1G17800 70 / 1e-15 AtENODL22 early nodulin-like protein 22 (.1)
AT5G26330 70 / 4e-15 Cupredoxin superfamily protein (.1)
AT2G32300 71 / 6e-15 UCC1 uclacyanin 1 (.1)
AT2G31050 69 / 1e-14 Cupredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026064 312 / 2e-110 AT5G15350 113 / 4e-32 early nodulin-like protein 17 (.1)
Lus10005229 84 / 2e-20 AT2G27035 124 / 7e-37 early nodulin-like protein 20 (.1)
Lus10005231 81 / 5e-19 AT5G15350 192 / 8e-63 early nodulin-like protein 17 (.1)
Lus10030690 80 / 6e-19 AT5G15350 190 / 4e-62 early nodulin-like protein 17 (.1)
Lus10002618 75 / 1e-17 AT3G27200 89 / 2e-23 Cupredoxin superfamily protein (.1)
Lus10012165 76 / 3e-17 AT5G07475 89 / 1e-22 Cupredoxin superfamily protein (.1)
Lus10026749 73 / 2e-16 AT2G27035 135 / 7e-41 early nodulin-like protein 20 (.1)
Lus10007026 72 / 4e-16 AT2G32300 96 / 4e-25 uclacyanin 1 (.1)
Lus10025536 72 / 5e-16 AT2G27035 148 / 5e-46 early nodulin-like protein 20 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G043600 200 / 2e-66 AT5G15350 121 / 2e-35 early nodulin-like protein 17 (.1)
Potri.003G183300 200 / 8e-66 AT5G15350 123 / 1e-35 early nodulin-like protein 17 (.1)
Potri.017G088600 96 / 4e-25 AT5G15350 194 / 5e-64 early nodulin-like protein 17 (.1)
Potri.003G117900 86 / 3e-21 AT3G17675 108 / 6e-31 Cupredoxin superfamily protein (.1)
Potri.017G088500 84 / 1e-20 AT2G27035 122 / 7e-36 early nodulin-like protein 20 (.1)
Potri.003G047300 81 / 4e-19 AT5G26330 121 / 2e-34 Cupredoxin superfamily protein (.1)
Potri.001G219800 80 / 8e-19 AT2G27035 130 / 1e-38 early nodulin-like protein 20 (.1)
Potri.004G121100 77 / 5e-18 AT5G15350 149 / 4e-46 early nodulin-like protein 17 (.1)
Potri.013G030000 77 / 5e-18 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.009G136200 75 / 3e-17 AT5G26330 88 / 4e-22 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10014356 pacid=23164704 polypeptide=Lus10014356 locus=Lus10014356.g ID=Lus10014356.BGIv1.0 annot-version=v1.0
ATGTCCACCAGCTCAACTAATTCAGCAGCTTATCCAATCTCGTTGGTGCTTTTTTGCATCCTCATCTCCTCAACCGCCGTCAACGGCACCGACCACATCG
TCGGAGTCAACAAGGGTTGGAATCCAGGCATCAACTACACTCTCTGGGCGAACAACCAAACCTTCTATGTTGGCGATTTCATCTCATTTAGGTACCAGAA
GACACAGTACAACGTTTTCAGAGTGAACGAGACTGGGTACGACAACTGTACGACGGAAGGAGCAACGGGGAACTGGAGCAGCGGGAAAGATTTCATTCTT
CTTGATATGGCTAAAAGATACTACTTTATTTGTGGGAATGGCCAGTGCTTTAACGGGATGAAGGTCTCTGTTGTTGTGCATCCTCTGCCGTCGCCGTCGG
GGGCTCCCGGCATGAATAGCACACATTCTGCTGCTGCTGCTCCGGTGGCTGCGGGGTTGGTTGGTTTCGGTTTGAGACAGGCCTTGGTTTTGGGGTTGGG
TTGTATCTGGTTTGGATTTAGCTGGTTGTGA
AA sequence
>Lus10014356 pacid=23164704 polypeptide=Lus10014356 locus=Lus10014356.g ID=Lus10014356.BGIv1.0 annot-version=v1.0
MSTSSTNSAAYPISLVLFCILISSTAVNGTDHIVGVNKGWNPGINYTLWANNQTFYVGDFISFRYQKTQYNVFRVNETGYDNCTTEGATGNWSSGKDFIL
LDMAKRYYFICGNGQCFNGMKVSVVVHPLPSPSGAPGMNSTHSAAAAPVAAGLVGFGLRQALVLGLGCIWFGFSWL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G15350 AtENODL17 early nodulin-like protein 17 ... Lus10014356 0 1
AT2G16850 PIP3B, PIP2;8 PLASMA MEMBRANE INTRINSIC PROT... Lus10039222 3.5 0.9462
AT2G37640 ATHEXPALPHA1.9,... ARABIDOPSIS THALIANA EXPANSIN ... Lus10010841 4.9 0.9474
AT3G08030 Protein of unknown function, D... Lus10039602 5.5 0.9465
AT3G27580 D6PKL3, ATPK7 D6 PROTEIN KINASE LIKE 3, Prot... Lus10022272 6.5 0.9002
AT1G23965 unknown protein Lus10030844 8.4 0.9180
AT1G05560 UGT75B1, UGT1 UDP-GLUCOSE TRANSFERASE 1, UDP... Lus10040590 8.8 0.9329
AT2G41640 Glycosyltransferase family 61 ... Lus10042044 9.1 0.9012
AT1G03170 FAF2 FANTASTIC FOUR 2, Protein of u... Lus10014665 9.5 0.9149
AT4G31470 CAP (Cysteine-rich secretory p... Lus10005557 9.8 0.9207
AT4G38840 SAUR-like auxin-responsive pro... Lus10008991 10.7 0.9393

Lus10014356 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.