Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G51560 73 / 3e-16 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT3G04210 71 / 2e-15 Disease resistance protein (TIR-NBS class) (.1) AT1G17600 70 / 4e-15 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT3G04220 70 / 4e-15 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72860 70 / 5e-15 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G38340 68 / 1e-14 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G14370 68 / 1e-14 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT2G14080 68 / 2e-14 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72890 67 / 3e-14 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) AT5G58120 67 / 4e-14 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032101 [exp] 185 / 7e-58 AT1G27170 270 / 6e-80 transmembrane receptors;ATP binding (.1.2) Lus10015453 [exp] 156 / 8e-47 AT1G27170 282 / 5e-84 transmembrane receptors;ATP binding (.1.2) Lus10001375 [exp] 121 / 3e-33 AT5G36930 464 / 3e-141 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10010574 [exp] 109 / 7e-29 AT5G36930 397 / 4e-119 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10014207 [exp] 108 / 8e-29 AT5G36930 446 / 5e-135 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10004911 [exp] 107 / 4e-28 AT1G27170 387 / 5e-115 transmembrane receptors;ATP binding (.1.2) Lus10001366 [exp] 106 / 8e-28 AT5G36930 424 / 1e-125 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10004257 [exp] 104 / 4e-27 AT5G36930 446 / 7e-136 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10022707 [exp] 100 / 3e-26 AT5G36930 280 / 5e-84 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G052000 [exp] 84 / 7e-20 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G021681 [exp] 83 / 8e-20 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T001500 [exp] 83 / 9e-20 AT5G36930 641 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.001G066500 [exp] 83 / 1e-19 AT5G36930 462 / 2e-146 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.003G084333 [exp] 80 / 1e-18 AT5G36930 347 / 2e-108 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.012G135700 [exp] 80 / 1e-18 AT5G36930 640 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.013G037599 [exp] 80 / 1e-18 AT5G36930 627 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002428 [exp] 79 / 2e-18 AT5G36930 387 / 2e-122 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G001600 [exp] 79 / 3e-18 AT5G36930 721 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T002400 [exp] 79 / 3e-18 AT5G36930 658 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00931 [flax] [poplar] NB-ARC NB-ARC domain
Representative CDS sequence Show only first row Show all	>Lus10014583 pacid=23170865 polypeptide=Lus10014583 locus=Lus10014583.g ID=Lus10014583.BGIv1.0 annot-version=v1.0 ATGGAATCATCCGGCCTCGTCGAGAATGCCAGCCAAGGAATCTACCTGATAAGAAACAGAGTTTGCAAGCATAAAGTTCTGATAGTTGTTGATGATGTTG ATAGGAAGTTTGAGTTTGATAAGGTGATGGGACACAGGGAATGGTTTTTGCCCGGGAGCAGGATTATTATCACGACGAGAGATAGAAAGGTTCTTAATAT GCTTAACGTGCGTGAGGTGTATGAACCGTCGGTGATGAGTGCAGAACATTCCCTGCAACTTTTCAGCAAGCATGCGTTCCAGAAGACTATGCAGAAATGT CTGCGGAGATTGTATCGGCCGTGGGGGGGATTCCTTTAG
AA sequence Show only first row Show all	>Lus10014583 pacid=23170865 polypeptide=Lus10014583 locus=Lus10014583.g ID=Lus10014583.BGIv1.0 annot-version=v1.0 MESSGLVENASQGIYLIRNRVCKHKVLIVVDDVDRKFEFDKVMGHREWFLPGSRIIITTRDRKVLNMLNVREVYEPSVMSAEHSLQLFSKHAFQKTMQKC LRRLYRPWGGFL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G51560			Disease resistance protein (TI...		Lus10014583 [exp]	0	1
AT1G58370		ATXYN1, RXF12	ARABIDOPSIS THALIANA XYLANASE ...		Lus10020790 [exp]	3.2	0.6494
AT1G51120	AP2_ERF		AP2/B3 transcription factor fa...		Lus10026212 [exp]	9.8	0.6554
AT3G14880			unknown protein		Lus10013746 [exp]	25.7	0.5921
					Lus10029472 [exp]	32.8	0.5845
AT1G66980		GDPDL2, SNC4	Glycerophosphodiester phosphod...		Lus10025549 [exp]	32.9	0.5726
AT5G05830			RING/FYVE/PHD zinc finger supe...		Lus10035549 [exp]	47.4	0.5896
AT1G27170			transmembrane receptors;ATP bi...		Lus10014582 [exp]	61.7	0.5587
AT1G34570			Essential protein Yae1, N-term...		Lus10019775 [exp]	78.1	0.5454
AT4G05130		ATENT4	equilibrative nucleoside trans...		Lus10002590 [exp]	109.7	0.5383
AT3G14040			Pectin lyase-like superfamily ...		Lus10038316 [exp]	122.2	0.5004

Compare expression of checked genes

Lus10014583 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.