Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G07590 158 / 1e-51 Small nuclear ribonucleoprotein family protein (.1.2) AT4G02840 157 / 3e-51 Small nuclear ribonucleoprotein family protein (.1.2) AT1G20580 47 / 8e-08 Small nuclear ribonucleoprotein family protein (.1) AT1G76300 45 / 7e-07 SMD3 snRNP core protein SMD3 (.1) AT5G27720 43 / 2e-06 LSM4, EMB1644 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) AT1G03330 37 / 0.0003 Small nuclear ribonucleoprotein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025186 [exp] 165 / 2e-54 AT3G07590 169 / 6e-56 Small nuclear ribonucleoprotein family protein (.1.2) Lus10028022 [exp] 164 / 5e-54 AT3G07590 181 / 1e-60 Small nuclear ribonucleoprotein family protein (.1.2) Lus10003727 [exp] 165 / 4e-53 AT3G07590 180 / 1e-58 Small nuclear ribonucleoprotein family protein (.1.2) Lus10013227 [exp] 46 / 2e-07 AT1G20580 214 / 2e-73 Small nuclear ribonucleoprotein family protein (.1) Lus10030747 [exp] 46 / 2e-07 AT1G20580 214 / 2e-73 Small nuclear ribonucleoprotein family protein (.1) Lus10016013 [exp] 46 / 3e-07 AT1G20580 219 / 3e-75 Small nuclear ribonucleoprotein family protein (.1) Lus10012263 [exp] 46 / 3e-07 AT1G20580 219 / 3e-75 Small nuclear ribonucleoprotein family protein (.1) Lus10029426 [exp] 43 / 1e-05 AT5G27720 190 / 2e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Lus10004221 [exp] 42 / 2e-05 AT5G27720 182 / 2e-57 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G054800 [exp] 159 / 4e-52 AT3G07590 183 / 1e-61 Small nuclear ribonucleoprotein family protein (.1.2) Potri.005G207900 [exp] 149 / 5e-48 AT4G02840 152 / 3e-49 Small nuclear ribonucleoprotein family protein (.1.2) Potri.002G010200 [exp] 48 / 5e-08 AT1G20580 214 / 5e-73 Small nuclear ribonucleoprotein family protein (.1) Potri.005G251100 [exp] 47 / 1e-07 AT1G20580 211 / 6e-72 Small nuclear ribonucleoprotein family protein (.1) Potri.002G205700 [exp] 43 / 4e-06 AT5G27720 179 / 5e-59 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Potri.014G130700 [exp] 42 / 1e-05 AT5G27720 176 / 7e-58 SM-like protein 4, embryo defective 1644, Small nuclear ribonucleoprotein family protein (.1) Potri.004G219000 [exp] 36 / 0.0007 AT1G03330 184 / 1e-62 Small nuclear ribonucleoprotein family protein (.1) Potri.003G014900 [exp] 36 / 0.0007 AT1G03330 184 / 1e-62 Small nuclear ribonucleoprotein family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [flax] [poplar] Sm-like PF01423 [flax] [poplar] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Lus10016068 pacid=23154415 polypeptide=Lus10016068 locus=Lus10016068.g ID=Lus10016068.BGIv1.0 annot-version=v1.0 ATGAAGCTGAACAACGAGACGGTGTCAATCGAGCTCAAGAACGGAACCGTCGTTCATGGAACCATCATAGGGGTTGATATTAGTATGAACACGCACTTGA AGACGGTGAAGATGACACTCAAGGGGAAGAATCCTGTAACTCTCGATCATCTAAGTGTCAGAGGAAACAACATCCGCTACTACATCCTCCCAGACAGCTT GAATCTGGAGACTTTACTGGTGGAGGAGACTCCGAAGATCAAGCCCAAGAAGGCTGTCGCTGGTAGGGCAGTGGGACGTGGTCGGGGAAGGGGTCGTGGA CGAGGACGTGGCCGTGGTCGTTAA
AA sequence Show only first row Show all	>Lus10016068 pacid=23154415 polypeptide=Lus10016068 locus=Lus10016068.g ID=Lus10016068.BGIv1.0 annot-version=v1.0 MKLNNETVSIELKNGTVVHGTIIGVDISMNTHLKTVKMTLKGKNPVTLDHLSVRGNNIRYYILPDSLNLETLLVEETPKIKPKKAVAGRAVGRGRGRGRG RGRGRGR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G07590			Small nuclear ribonucleoprotei...		Lus10016068 [exp]	0	1
AT3G07590			Small nuclear ribonucleoprotei...		Lus10025186 [exp]	1.4	0.8853
AT1G71850			Ubiquitin carboxyl-terminal hy...		Lus10005750 [exp]	2.8	0.8515
AT4G21110			G10 family protein (.1)		Lus10014385 [exp]	4.0	0.8698
AT5G23740		RPS11-BETA	ribosomal protein S11-beta (.1...		Lus10005348 [exp]	4.6	0.8704
AT4G39200			Ribosomal protein S25 family p...		Lus10035060 [exp]	6.0	0.8636
AT1G73940			unknown protein		Lus10010150 [exp]	6.6	0.8389
AT2G47580		U1A	spliceosomal protein U1A (.1)		Lus10003358 [exp]	6.7	0.8662
AT3G16080			Zinc-binding ribosomal protein...		Lus10011446 [exp]	7.2	0.8709
AT2G21240	BBR_BPC	BPC4, BBR/BPC4,...	basic pentacysteine 4 (.1.2)		Lus10031078 [exp]	7.9	0.8580
AT5G27650			Tudor/PWWP/MBT superfamily pro...		Lus10043114 [exp]	8.5	0.8503

Compare expression of checked genes

Lus10016068 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.