Lus10016209 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44840 143 / 1e-42 AP2_ERF ATERF13, EREBP ethylene-responsive element binding factor 13 (.1)
AT5G47220 119 / 3e-33 AP2_ERF ATERF-2, ERF2, ATERF2 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1)
AT4G17500 117 / 4e-32 AP2_ERF ATERF-1, AtERF1 ethylene responsive element binding factor 1 (.1)
AT3G23230 102 / 1e-27 AP2_ERF ERF98 Integrase-type DNA-binding superfamily protein (.1)
AT2G33710 99 / 1e-25 AP2_ERF Integrase-type DNA-binding superfamily protein (.1.2)
AT5G13330 98 / 3e-25 AP2_ERF RAP2.6L related to AP2 6l (.1)
AT3G23240 98 / 4e-25 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1)
AT5G43410 94 / 2e-24 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT5G51190 96 / 3e-24 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT5G61600 96 / 5e-24 AP2_ERF ERF104 ethylene response factor 104 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029334 270 / 7e-93 AT2G44840 152 / 1e-46 ethylene-responsive element binding factor 13 (.1)
Lus10016211 262 / 1e-89 AT2G44840 158 / 2e-48 ethylene-responsive element binding factor 13 (.1)
Lus10029333 251 / 1e-85 AT2G44840 147 / 1e-44 ethylene-responsive element binding factor 13 (.1)
Lus10016225 247 / 1e-83 AT2G44840 154 / 4e-47 ethylene-responsive element binding factor 13 (.1)
Lus10016210 233 / 2e-78 AT2G44840 154 / 7e-47 ethylene-responsive element binding factor 13 (.1)
Lus10029314 171 / 8e-54 AT2G44840 139 / 6e-41 ethylene-responsive element binding factor 13 (.1)
Lus10016227 171 / 1e-53 AT2G44840 134 / 3e-39 ethylene-responsive element binding factor 13 (.1)
Lus10004011 163 / 1e-50 AT2G44840 132 / 2e-38 ethylene-responsive element binding factor 13 (.1)
Lus10030261 160 / 3e-49 AT2G44840 125 / 1e-35 ethylene-responsive element binding factor 13 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G046700 169 / 7e-53 AT2G44840 168 / 3e-52 ethylene-responsive element binding factor 13 (.1)
Potri.014G046900 154 / 4e-47 AT2G44840 164 / 2e-50 ethylene-responsive element binding factor 13 (.1)
Potri.014G047000 153 / 4e-47 AT2G44840 160 / 2e-49 ethylene-responsive element binding factor 13 (.1)
Potri.014G046600 148 / 1e-44 AT2G44840 196 / 3e-63 ethylene-responsive element binding factor 13 (.1)
Potri.014G046800 127 / 6e-38 AT2G44840 130 / 7e-39 ethylene-responsive element binding factor 13 (.1)
Potri.003G150700 128 / 1e-36 AT4G17500 190 / 9e-60 ethylene responsive element binding factor 1 (.1)
Potri.001G079900 125 / 3e-35 AT4G17500 186 / 2e-58 ethylene responsive element binding factor 1 (.1)
Potri.003G081200 122 / 3e-34 AT4G17500 211 / 1e-67 ethylene responsive element binding factor 1 (.1)
Potri.001G154100 120 / 4e-33 AT4G17500 221 / 2e-71 ethylene responsive element binding factor 1 (.1)
Potri.004G051700 108 / 9e-30 AT5G47220 111 / 1e-30 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0081 MBD-like PF00847 AP2 AP2 domain
Representative CDS sequence
>Lus10016209 pacid=23142704 polypeptide=Lus10016209 locus=Lus10016209.g ID=Lus10016209.BGIv1.0 annot-version=v1.0
ATGATGTCTACCCAGATTGAAGCTCTACAATCCATCCGCAACCACCTTTTCGACGACGATTCGGAATCGGGACTGATCACCTCCAATGCGACGTCGTTTT
GTGCCGAGTTTCGGAGCTTCAGCACGCTCCTCGAGGCCGATAACTGGAGCGACATTCTGTCCCAGTTGGCCGATGATGCTTCGACTGTACAAGTAGTGGA
TAATGACGTGGCGTTGCCTAAGAAGGCGGGTTACAAGGGAGTGAGGAGACGGCCGTGGGGGAAATACGCGGCGGAGATTAGAGATCCAAAGCGAAACGGC
GCTAGGCTATGGTTGGGGACTTACGAGACTCCTGAGGATGCGGCTCTTGCTTACGATAGAGTCGCTTTCCAGATGAGGGGAGCTAGGGCTAAGCTCAACT
TCCCGCATCTGGTGGGATCTAATGATTATGAGCCCGTTAGAGTGACTAACAAGAAACGTAACTCGCCGGAGCCATCATCCGCCGGGGCCTCATCGTCGGG
ATCGGGAGCTGAATCTCCAAAGGCTAAACGAAGAATGAGTTTGCTGCTTGAGTCTTATGTCGAAGAGGAGTGTGGGACCAGTCAAATGCCATTTGGCAGT
GAACTATCAGCTAGTCAATAG
AA sequence
>Lus10016209 pacid=23142704 polypeptide=Lus10016209 locus=Lus10016209.g ID=Lus10016209.BGIv1.0 annot-version=v1.0
MMSTQIEALQSIRNHLFDDDSESGLITSNATSFCAEFRSFSTLLEADNWSDILSQLADDASTVQVVDNDVALPKKAGYKGVRRRPWGKYAAEIRDPKRNG
ARLWLGTYETPEDAALAYDRVAFQMRGARAKLNFPHLVGSNDYEPVRVTNKKRNSPEPSSAGASSSGSGAESPKAKRRMSLLLESYVEEECGTSQMPFGS
ELSASQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10016209 0 1
AT5G51950 Glucose-methanol-choline (GMC)... Lus10038891 8.8 0.6990
AT5G65750 2-oxoglutarate dehydrogenase, ... Lus10029463 15.3 0.6427
AT3G26040 HXXXD-type acyl-transferase fa... Lus10000319 17.1 0.6939
AT1G24420 HXXXD-type acyl-transferase fa... Lus10036077 44.5 0.6228
AT1G10010 AAP8, ATAAP8 amino acid permease 8 (.1) Lus10037248 74.9 0.5851
AT1G35710 Protein kinase family protein ... Lus10002293 75.1 0.5466
AT2G28720 Histone superfamily protein (.... Lus10025313 78.6 0.5831
AT4G15050 Protein of Unknown Function (D... Lus10002231 102.4 0.5462
AT2G29490 GST19, ATGSTU1 GLUTATHIONE S-TRANSFERASE 19, ... Lus10007896 105.9 0.5568
AT5G59790 Domain of unknown function (DU... Lus10030328 109.5 0.5074

Lus10016209 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.