Lus10016210 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44840 147 / 2e-44 AP2_ERF ATERF13, EREBP ethylene-responsive element binding factor 13 (.1)
AT5G47220 120 / 9e-34 AP2_ERF ATERF-2, ERF2, ATERF2 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1)
AT4G17500 118 / 1e-32 AP2_ERF ATERF-1, AtERF1 ethylene responsive element binding factor 1 (.1)
AT2G33710 103 / 3e-27 AP2_ERF Integrase-type DNA-binding superfamily protein (.1.2)
AT3G23240 101 / 1e-26 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1)
AT5G51190 101 / 2e-26 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT3G23230 98 / 4e-26 AP2_ERF ERF98 Integrase-type DNA-binding superfamily protein (.1)
AT5G61600 100 / 7e-26 AP2_ERF ERF104 ethylene response factor 104 (.1)
AT5G13330 98 / 2e-25 AP2_ERF RAP2.6L related to AP2 6l (.1)
AT5G43410 95 / 5e-25 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029333 270 / 5e-93 AT2G44840 147 / 1e-44 ethylene-responsive element binding factor 13 (.1)
Lus10016225 264 / 3e-90 AT2G44840 154 / 4e-47 ethylene-responsive element binding factor 13 (.1)
Lus10016211 248 / 7e-84 AT2G44840 158 / 2e-48 ethylene-responsive element binding factor 13 (.1)
Lus10029334 240 / 4e-81 AT2G44840 152 / 1e-46 ethylene-responsive element binding factor 13 (.1)
Lus10016209 234 / 7e-79 AT2G44840 148 / 1e-44 ethylene-responsive element binding factor 13 (.1)
Lus10029314 189 / 7e-61 AT2G44840 139 / 6e-41 ethylene-responsive element binding factor 13 (.1)
Lus10016227 181 / 6e-58 AT2G44840 134 / 3e-39 ethylene-responsive element binding factor 13 (.1)
Lus10004011 160 / 1e-49 AT2G44840 132 / 2e-38 ethylene-responsive element binding factor 13 (.1)
Lus10030261 158 / 1e-48 AT2G44840 125 / 1e-35 ethylene-responsive element binding factor 13 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G046700 157 / 5e-48 AT2G44840 168 / 3e-52 ethylene-responsive element binding factor 13 (.1)
Potri.014G047000 148 / 3e-45 AT2G44840 160 / 2e-49 ethylene-responsive element binding factor 13 (.1)
Potri.014G046600 149 / 7e-45 AT2G44840 196 / 3e-63 ethylene-responsive element binding factor 13 (.1)
Potri.014G046800 133 / 5e-40 AT2G44840 130 / 7e-39 ethylene-responsive element binding factor 13 (.1)
Potri.014G046900 135 / 2e-39 AT2G44840 164 / 2e-50 ethylene-responsive element binding factor 13 (.1)
Potri.003G150700 128 / 1e-36 AT4G17500 190 / 9e-60 ethylene responsive element binding factor 1 (.1)
Potri.001G079900 125 / 1e-35 AT4G17500 186 / 2e-58 ethylene responsive element binding factor 1 (.1)
Potri.001G154100 122 / 9e-34 AT4G17500 221 / 2e-71 ethylene responsive element binding factor 1 (.1)
Potri.003G081200 121 / 9e-34 AT4G17500 211 / 1e-67 ethylene responsive element binding factor 1 (.1)
Potri.004G051700 111 / 7e-31 AT5G47220 111 / 1e-30 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0081 MBD-like PF00847 AP2 AP2 domain
Representative CDS sequence
>Lus10016210 pacid=23142705 polypeptide=Lus10016210 locus=Lus10016210.g ID=Lus10016210.BGIv1.0 annot-version=v1.0
ATGTCTACCCAGATTCAAGCCCTGGAATCAATCCGAAACTACCTTTTCAACGAAGACTCCGAATCGGCTGCTCTCACCTCCGATACAGCGTCGTTGCATT
CCGGCTGCCTGCAGAGCTTCAGCTCGCTCCTCGGCGCAGATTATAACTGGTGCGACATTTTTTCCGAATTAACAGATTCAACCGTAGAATCGAAGGACGA
ACTGCTGCCAACCGTGGTGATGCCGAAGAAGAAGGCGAATAATTACAAGGGAGTTCGGAGACGGCCGTGGGGGAAGTACGCGGCTGAGATTAGGGATCCG
AAGCGAAACGGCGCTAGGATATGGTTGGGGACTTACGAGACTCCGGAAGATGCAGCCCTGGCTTACGACAGAGCTGCTTTTCAGATGAGGGGAGCTAAGT
CTAAGCTCAATTTTCCACATCTGGTGGGGTCTACTGATTACGAGCCCGTTAGAGTGACCAACAAAAAGCGTGGCTCGCCGGAGCAATCATCCTCATCGTC
AGCGGTTTCGGGGTCGGAAAATGAATCTCCGGAGCCCAAACGAAGGATGAGTTTGCTTGAGTGGTCCTACGTGGAAGATGAGTGGGACCAGTCAAATGCC
ATTTGGCAATGA
AA sequence
>Lus10016210 pacid=23142705 polypeptide=Lus10016210 locus=Lus10016210.g ID=Lus10016210.BGIv1.0 annot-version=v1.0
MSTQIQALESIRNYLFNEDSESAALTSDTASLHSGCLQSFSSLLGADYNWCDIFSELTDSTVESKDELLPTVVMPKKKANNYKGVRRRPWGKYAAEIRDP
KRNGARIWLGTYETPEDAALAYDRAAFQMRGAKSKLNFPHLVGSTDYEPVRVTNKKRGSPEQSSSSSAVSGSENESPEPKRRMSLLEWSYVEDEWDQSNA
IWQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10016210 0 1
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10016211 1.7 0.8782
AT5G45890 SAG12 senescence-associated gene 12 ... Lus10026073 3.3 0.7485
AT3G52360 unknown protein Lus10029348 5.2 0.7981
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10029332 13.6 0.7839
AT1G79460 ATKS1, ATKS, GA... GA REQUIRING 2, ARABIDOPSIS TH... Lus10004443 29.6 0.7847
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10029318 34.8 0.7658
AT3G04720 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-rela... Lus10020250 50.0 0.6687
AT2G26975 Ctr copper transporter family ... Lus10017205 62.5 0.6784
Lus10000576 70.6 0.6619
AT3G26300 CYP71B34 "cytochrome P450, family 71, s... Lus10031674 79.3 0.7143

Lus10016210 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.