Lus10016223 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44840 137 / 5e-41 AP2_ERF ATERF13, EREBP ethylene-responsive element binding factor 13 (.1)
AT5G47220 112 / 7e-31 AP2_ERF ATERF-2, ERF2, ATERF2 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1)
AT4G17500 112 / 8e-31 AP2_ERF ATERF-1, AtERF1 ethylene responsive element binding factor 1 (.1)
AT3G23230 98 / 2e-26 AP2_ERF ERF98 Integrase-type DNA-binding superfamily protein (.1)
AT3G23240 97 / 3e-25 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1)
AT5G43410 94 / 6e-25 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT5G51190 94 / 7e-24 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT5G13330 93 / 9e-24 AP2_ERF RAP2.6L related to AP2 6l (.1)
AT5G47230 94 / 1e-23 AP2_ERF ATERF5, ATERF-5, ERF5 ETHYLENE RESPONSIVE ELEMENT BINDING FACTOR- 5, ethylene responsive element binding factor 5 (.1)
AT2G33710 93 / 1e-23 AP2_ERF Integrase-type DNA-binding superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029319 214 / 5e-72 AT2G44840 142 / 6e-43 ethylene-responsive element binding factor 13 (.1)
Lus10016224 173 / 4e-55 AT2G44840 143 / 1e-42 ethylene-responsive element binding factor 13 (.1)
Lus10029318 169 / 2e-53 AT2G44840 140 / 1e-41 ethylene-responsive element binding factor 13 (.1)
Lus10016212 166 / 6e-52 AT2G44840 146 / 1e-43 ethylene-responsive element binding factor 13 (.1)
Lus10029331 163 / 7e-51 AT2G44840 147 / 4e-44 ethylene-responsive element binding factor 13 (.1)
Lus10016210 149 / 6e-46 AT2G44840 154 / 7e-47 ethylene-responsive element binding factor 13 (.1)
Lus10016211 149 / 1e-45 AT2G44840 158 / 2e-48 ethylene-responsive element binding factor 13 (.1)
Lus10016225 149 / 2e-45 AT2G44840 154 / 4e-47 ethylene-responsive element binding factor 13 (.1)
Lus10029334 148 / 2e-45 AT2G44840 152 / 1e-46 ethylene-responsive element binding factor 13 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G046700 142 / 7e-43 AT2G44840 168 / 3e-52 ethylene-responsive element binding factor 13 (.1)
Potri.014G047000 139 / 5e-42 AT2G44840 160 / 2e-49 ethylene-responsive element binding factor 13 (.1)
Potri.014G046600 136 / 2e-40 AT2G44840 196 / 3e-63 ethylene-responsive element binding factor 13 (.1)
Potri.014G046800 126 / 8e-38 AT2G44840 130 / 7e-39 ethylene-responsive element binding factor 13 (.1)
Potri.014G046900 119 / 7e-34 AT2G44840 164 / 2e-50 ethylene-responsive element binding factor 13 (.1)
Potri.003G150700 118 / 3e-33 AT4G17500 190 / 9e-60 ethylene responsive element binding factor 1 (.1)
Potri.001G079900 116 / 3e-32 AT4G17500 186 / 2e-58 ethylene responsive element binding factor 1 (.1)
Potri.001G154100 115 / 1e-31 AT4G17500 221 / 2e-71 ethylene responsive element binding factor 1 (.1)
Potri.003G081200 114 / 1e-31 AT4G17500 211 / 1e-67 ethylene responsive element binding factor 1 (.1)
Potri.004G051700 108 / 3e-30 AT5G47220 111 / 1e-30 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0081 MBD-like PF00847 AP2 AP2 domain
Representative CDS sequence
>Lus10016223 pacid=23142648 polypeptide=Lus10016223 locus=Lus10016223.g ID=Lus10016223.BGIv1.0 annot-version=v1.0
ATGGACGATTCTTTTTCTTCTTCATCATCATCAGATCCTGCAGCATTTCTGGATTCCATCCATCACTTGATTCTTTCAAAAGACCTTGACGACGTCGTCC
TCGCCACTGCTACTACTACTACTACTACTCCTCCTTCTTCTTCTACTACCGTCCCAGCCGTTGAAGAGAAGAGATCTGCAGGGATAAGTACGTCCACGTG
GCAGTTCAAGGGGGTCAGGAGGCGTCCGTGGGGGAAGTACGCTGCCGAGATAAGGGATCCGAAGCGAAACGGTGCTAGGATATGGTTGGGGACTTACGAG
TGTCCGGAAGATGCGGCTTTGGCTTACGACAGAGCTGCTTTTGAGATGCGGGGAGCTAAGGCTAAGCTCAATTTTCCGCATCTGGTTGGGTCTGCTGAGT
ACCAGCCAGTTCGGGTTACGAATGTTAAGAAGCGGGCGGTTGATGATGAAGATCGGACTGGCGAGGCGAATGATCCCGAGTTGAAGCGGGTCAAGCCGGC
GGATTTCCAAACTTGA
AA sequence
>Lus10016223 pacid=23142648 polypeptide=Lus10016223 locus=Lus10016223.g ID=Lus10016223.BGIv1.0 annot-version=v1.0
MDDSFSSSSSSDPAAFLDSIHHLILSKDLDDVVLATATTTTTTPPSSSTTVPAVEEKRSAGISTSTWQFKGVRRRPWGKYAAEIRDPKRNGARIWLGTYE
CPEDAALAYDRAAFEMRGAKAKLNFPHLVGSAEYQPVRVTNVKKRAVDDEDRTGEANDPELKRVKPADFQT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10016223 0 1
AT4G25150 HAD superfamily, subfamily III... Lus10006849 1.0 0.9668
AT2G47460 MYB PFG1, ATMYB12 PRODUCTION OF FLAVONOL GLYCOSI... Lus10001458 1.7 0.9555
Lus10012313 2.2 0.9450
AT4G16740 ATTPS03 terpene synthase 03 (.1.2) Lus10012312 3.5 0.9612
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10029318 3.9 0.9280
AT1G14180 RING/U-box superfamily protein... Lus10036764 7.7 0.9532
Lus10008233 8.8 0.9371
AT5G19790 AP2_ERF RAP2.11 related to AP2 11 (.1) Lus10010652 9.8 0.9397
AT2G36780 UDP-Glycosyltransferase superf... Lus10012011 10.4 0.9386
AT1G14185 Glucose-methanol-choline (GMC)... Lus10032347 11.5 0.9396

Lus10016223 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.