Lus10016224 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44840 140 / 2e-41 AP2_ERF ATERF13, EREBP ethylene-responsive element binding factor 13 (.1)
AT4G17500 119 / 9e-33 AP2_ERF ATERF-1, AtERF1 ethylene responsive element binding factor 1 (.1)
AT5G47220 113 / 8e-31 AP2_ERF ATERF-2, ERF2, ATERF2 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1)
AT3G23230 99 / 2e-26 AP2_ERF ERF98 Integrase-type DNA-binding superfamily protein (.1)
AT3G23240 99 / 2e-25 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1)
AT5G43410 94 / 1e-24 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT5G07580 97 / 2e-24 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT5G51190 96 / 3e-24 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT5G13330 95 / 3e-24 AP2_ERF RAP2.6L related to AP2 6l (.1)
AT2G33710 95 / 5e-24 AP2_ERF Integrase-type DNA-binding superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029318 303 / 1e-105 AT2G44840 140 / 1e-41 ethylene-responsive element binding factor 13 (.1)
Lus10029331 216 / 4e-71 AT2G44840 147 / 4e-44 ethylene-responsive element binding factor 13 (.1)
Lus10016212 207 / 1e-67 AT2G44840 146 / 1e-43 ethylene-responsive element binding factor 13 (.1)
Lus10016223 175 / 6e-56 AT2G44840 144 / 1e-43 ethylene-responsive element binding factor 13 (.1)
Lus10029319 167 / 6e-53 AT2G44840 142 / 6e-43 ethylene-responsive element binding factor 13 (.1)
Lus10016210 158 / 7e-49 AT2G44840 154 / 7e-47 ethylene-responsive element binding factor 13 (.1)
Lus10029333 155 / 1e-47 AT2G44840 147 / 1e-44 ethylene-responsive element binding factor 13 (.1)
Lus10016225 155 / 2e-47 AT2G44840 154 / 4e-47 ethylene-responsive element binding factor 13 (.1)
Lus10029334 154 / 2e-47 AT2G44840 152 / 1e-46 ethylene-responsive element binding factor 13 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G046700 146 / 8e-44 AT2G44840 168 / 3e-52 ethylene-responsive element binding factor 13 (.1)
Potri.014G047000 142 / 1e-42 AT2G44840 160 / 2e-49 ethylene-responsive element binding factor 13 (.1)
Potri.014G046600 140 / 2e-41 AT2G44840 196 / 3e-63 ethylene-responsive element binding factor 13 (.1)
Potri.014G046800 125 / 4e-37 AT2G44840 130 / 7e-39 ethylene-responsive element binding factor 13 (.1)
Potri.003G150700 124 / 7e-35 AT4G17500 190 / 9e-60 ethylene responsive element binding factor 1 (.1)
Potri.001G079900 120 / 1e-33 AT4G17500 186 / 2e-58 ethylene responsive element binding factor 1 (.1)
Potri.014G046900 119 / 2e-33 AT2G44840 164 / 2e-50 ethylene-responsive element binding factor 13 (.1)
Potri.003G081200 117 / 4e-32 AT4G17500 211 / 1e-67 ethylene responsive element binding factor 1 (.1)
Potri.001G154100 115 / 3e-31 AT4G17500 221 / 2e-71 ethylene responsive element binding factor 1 (.1)
Potri.004G051700 108 / 7e-30 AT5G47220 111 / 1e-30 ETHYLENE RESPONSE FACTOR- 2, ethylene responsive element binding factor 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0081 MBD-like PF00847 AP2 AP2 domain
Representative CDS sequence
>Lus10016224 pacid=23142680 polypeptide=Lus10016224 locus=Lus10016224.g ID=Lus10016224.BGIv1.0 annot-version=v1.0
ATGTGGGGATATTCTGAAGAGACTGACATAATCGACACCTTATTCATGGACGATTATTCTTCAGATCCTTCATTCCTTGATTCCATCCACCATTTCCTCA
TTTCCGGCGACTTTGAAAACGACGTCGTCCCCAGTAGTAGCCCTTCTTCTTCTACCACTACCACCACTACTACCAGCAGCACCCAGATCTCCGCCGTTCA
GTCTCGTACTACCGTCAGCTGTCAGATGGTCTCCACCGTTCAATCCCCTACGGACGCCGACGTTCCGAGTAATATTAATAGCAACAACAACAAGGAGATC
AAGAAGAAGAGACCAGGGACGTCCACGTGGCAGTTCAAAGGAGTAAGGAGGCGTCCATGGGGCAAATACGCTGCGGAGATCAGGGACCCGAAGCGTAACG
GTGCTAGGATATGGTTGGGTACTTATGAGTCTCCGGAAGACGCGGCTCTAGCTTACGACAGAGCCGCTTTCGAGATGCGGGGAGCTAAGGCTAAGCTCAA
CTTCCCGCATTTGGTGGGGTCGACTGAGTACGAGCCGGTTCGAGTTACGAACGGTAAAAAGCGGATGGCTGATCAGACCGATCACTGCTCTCCGAAGCCG
AAGCGGATCCTCCAATTCCAAACTTAA
AA sequence
>Lus10016224 pacid=23142680 polypeptide=Lus10016224 locus=Lus10016224.g ID=Lus10016224.BGIv1.0 annot-version=v1.0
MWGYSEETDIIDTLFMDDYSSDPSFLDSIHHFLISGDFENDVVPSSSPSSSTTTTTTTSSTQISAVQSRTTVSCQMVSTVQSPTDADVPSNINSNNNKEI
KKKRPGTSTWQFKGVRRRPWGKYAAEIRDPKRNGARIWLGTYESPEDAALAYDRAAFEMRGAKAKLNFPHLVGSTEYEPVRVTNGKKRMADQTDHCSPKP
KRILQFQT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10016224 0 1
Lus10003636 1.0 0.9566
AT1G73920 alpha/beta-Hydrolases superfam... Lus10032477 1.7 0.8343
Lus10005608 2.4 0.8750
Lus10009363 6.2 0.7640
AT1G14185 Glucose-methanol-choline (GMC)... Lus10030461 8.6 0.7717
AT4G18450 AP2_ERF Integrase-type DNA-binding sup... Lus10013958 11.1 0.6556
AT3G42640 AHA8 H\(+\)-ATPase 8, H\(+\)-ATPase... Lus10019064 11.6 0.8146
AT2G14378 Protein of unknown function (D... Lus10034455 12.3 0.8294
Lus10039737 13.2 0.7734
Lus10022805 13.8 0.8294

Lus10016224 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.