Lus10016525 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G60340 213 / 3e-71 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040792 299 / 4e-105 AT5G60340 258 / 8e-89 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G109400 250 / 7e-86 AT5G60340 231 / 4e-78 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.006G228500 249 / 1e-85 AT5G60340 228 / 5e-77 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00004 AAA ATPase family associated with various cellular activities (AAA)
Representative CDS sequence
>Lus10016525 pacid=23144887 polypeptide=Lus10016525 locus=Lus10016525.g ID=Lus10016525.BGIv1.0 annot-version=v1.0
ATGGCGGGAGAAGCAAAGAGGACGAAACCAAACATACTGATAACGGGAACACCAGGGACCGGGAAAACGACGACGTCTTCAGCTTTGGCGGAGGCGTTGC
AGCTCCGCCACATCAACATCGGAGATTTAGTAAAGGAGAAGAAGTTGCACGACGGCTGGGACGATCAATTCGAATGCCATGTCATCAACGAGGATCTGGT
TTGCGATGAAATAGAGGACGCTATGGAAGAAGGAGGGAACATAGTGGACTACCACGGCTGCGATTTTTTCCCGGAGCGGTGGTTCGACCGGGTGGTGGTT
CTCCAAACCGAAAACTCAGTGTTGTTTGACCGCTTGAGCAAGAGGGGATACTCGGAGACCAAGGTTAAGAACAACATAGAGTGCGAGATCTTCCAAGTAC
TGCTGGAGGAGGCCAAAGATAGCTACCCTGAACACATTGTTGTCGCTCTTCGTAGTGATTCGGTTGAAGATGTTTCGAGTAATGTCGAGTCTCTTTCGGA
ATGGTTCAGGAACTGGCAACCTGCTGCTTCTTCCTCCTGA
AA sequence
>Lus10016525 pacid=23144887 polypeptide=Lus10016525 locus=Lus10016525.g ID=Lus10016525.BGIv1.0 annot-version=v1.0
MAGEAKRTKPNILITGTPGTGKTTTSSALAEALQLRHINIGDLVKEKKLHDGWDDQFECHVINEDLVCDEIEDAMEEGGNIVDYHGCDFFPERWFDRVVV
LQTENSVLFDRLSKRGYSETKVKNNIECEIFQVLLEEAKDSYPEHIVVALRSDSVEDVSSNVESLSEWFRNWQPAASSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G60340 P-loop containing nucleoside t... Lus10016525 0 1
AT4G36420 Ribosomal protein L12 family p... Lus10028336 2.4 0.8012
AT2G18196 Heavy metal transport/detoxifi... Lus10010147 4.2 0.8282
AT1G20430 unknown protein Lus10034561 4.2 0.8273
AT3G10090 Nucleic acid-binding, OB-fold-... Lus10029320 4.6 0.8244
AT1G51510 Y14 RNA-binding (RRM/RBD/RNP motif... Lus10003632 7.4 0.8043
AT5G52840 NADH-ubiquinone oxidoreductase... Lus10014951 8.9 0.7892
AT3G06610 DNA-binding enhancer protein-r... Lus10037773 9.8 0.8243
AT2G18400 ribosomal protein L6 family pr... Lus10014306 12.7 0.7827
AT4G18905 Transducin/WD40 repeat-like su... Lus10015348 14.0 0.7729
AT1G26880 Ribosomal protein L34e superfa... Lus10042199 14.7 0.7993

Lus10016525 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.