Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G18590 69 / 2e-15 AtENODL5 early nodulin-like protein 5 (.1) AT1G48940 67 / 6e-15 AtENODL6 early nodulin-like protein 6 (.1) AT1G79800 67 / 2e-14 AtENODL7 early nodulin-like protein 7 (.1) AT2G25060 62 / 7e-13 AtENODL14 early nodulin-like protein 14 (.1) AT4G28365 56 / 1e-10 AtENODL3 early nodulin-like protein 3 (.1) AT4G32490 56 / 2e-10 AtENODL4 early nodulin-like protein 4 (.1) AT4G27520 56 / 3e-10 AtENODL2 early nodulin-like protein 2 (.1) AT5G57920 55 / 3e-10 AtENODL10 early nodulin-like protein 10 (.1) AT5G14345 54 / 6e-10 AtENODL21 early nodulin-like protein 21 (.1) AT4G31840 53 / 1e-09 AtENODL15 early nodulin-like protein 15 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022522 [exp] 203 / 6e-68 AT3G18590 95 / 2e-24 early nodulin-like protein 5 (.1) Lus10032111 [exp] 68 / 4e-15 AT5G14345 147 / 1e-45 early nodulin-like protein 21 (.1) Lus10009617 [exp] 63 / 6e-13 AT3G18590 148 / 1e-45 early nodulin-like protein 5 (.1) Lus10003432 [exp] 62 / 1e-12 AT5G25090 167 / 5e-53 early nodulin-like protein 13 (.1) Lus10026880 [exp] 62 / 2e-12 AT5G25090 167 / 8e-53 early nodulin-like protein 13 (.1) Lus10014880 [exp] 61 / 2e-12 AT3G18590 144 / 1e-43 early nodulin-like protein 5 (.1) Lus10018617 [exp] 59 / 1e-11 AT4G28365 150 / 5e-46 early nodulin-like protein 3 (.1) Lus10022318 [exp] 57 / 9e-11 AT3G18590 146 / 4e-45 early nodulin-like protein 5 (.1) Lus10009196 [exp] 56 / 6e-10 AT5G53870 154 / 3e-44 early nodulin-like protein 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G264600 [exp] 74 / 1e-17 AT2G25060 184 / 9e-60 early nodulin-like protein 14 (.1) Potri.015G052000 [exp] 68 / 3e-15 AT1G48940 163 / 1e-51 early nodulin-like protein 6 (.1) Potri.018G018200 [exp] 64 / 1e-13 AT2G25060 177 / 7e-57 early nodulin-like protein 14 (.1) Potri.001G187700 [exp] 60 / 4e-12 AT1G79800 176 / 2e-56 early nodulin-like protein 7 (.1) Potri.006G184100 [exp] 58 / 2e-11 AT4G31840 174 / 5e-56 early nodulin-like protein 15 (.1) Potri.011G135400 [exp] 57 / 8e-11 AT3G20570 138 / 4e-41 early nodulin-like protein 9 (.1) Potri.017G011200 [exp] 57 / 1e-10 AT4G32490 157 / 2e-48 early nodulin-like protein 4 (.1) Potri.001G338800 [exp] 55 / 4e-10 AT5G14345 145 / 6e-45 early nodulin-like protein 21 (.1) Potri.001G419200 [exp] 55 / 5e-10 AT3G20570 153 / 1e-46 early nodulin-like protein 9 (.1) Potri.011G117800 [exp] 56 / 6e-10 AT5G53870 158 / 3e-45 early nodulin-like protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0026 [flax] [poplar] CU_oxidase PF02298 [flax] [poplar] Cu_bind_like Plastocyanin-like domain
Representative CDS sequence Show only first row Show all	>Lus10016621 pacid=23143923 polypeptide=Lus10016621 locus=Lus10016621.g ID=Lus10016621.BGIv1.0 annot-version=v1.0 ATGCTTTCAGTTTTCGTTTACAGCAGCAATGAATCTGACTCGGTGCTGCTAGTTAACTCCATTGCCTACTCCAACTGCATCCTCTCCCATCCAATCCTCC GGCTTGAAAACACCACTTTCCAGTTAGATCGGCCAGGTCTATTCTACTTCATCAGCGGCCAGGCCGGGAGCTGCATTGCCGGACAGAAGCTGGTGGTCCG AGTCATGGACGACGAACAACAAGATACAGGACCAAGCCCTGCTCCTGGTAGTAAGGATCTGATATGGGATGGTCTAAACTGGCCGCCGGCCATTAATTCA ACCGTTAAAACCACCATTGCCTCCTACTTCATCACTGCTCTTGGCGGTGTCCTCGTCATTCTCTACTTGCTGATGTAG
AA sequence Show only first row Show all	>Lus10016621 pacid=23143923 polypeptide=Lus10016621 locus=Lus10016621.g ID=Lus10016621.BGIv1.0 annot-version=v1.0 MLSVFVYSSNESDSVLLVNSIAYSNCILSHPILRLENTTFQLDRPGLFYFISGQAGSCIAGQKLVVRVMDDEQQDTGPSPAPGSKDLIWDGLNWPPAINS TVKTTIASYFITALGGVLVILYLLM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G18590		AtENODL5	early nodulin-like protein 5 (...		Lus10016621 [exp]	0	1
AT2G04520			Nucleic acid-binding, OB-fold-...		Lus10042438 [exp]	6.5	0.5668
AT5G20630		ATGER3, GLP3A, ...	GERMIN-LIKE PROTEIN 3, ARABIDO...		Lus10015645 [exp]	84.3	0.4805
AT2G32030			Acyl-CoA N-acyltransferases (N...		Lus10039346 [exp]	87.3	0.4467
					Lus10013881 [exp]	98.5	0.4738
AT1G26730			EXS (ERD1/XPR1/SYG1) family pr...		Lus10004284 [exp]	111.7	0.4684
					Lus10030782 [exp]	118.2	0.4626
AT3G07120			RING/U-box superfamily protein...		Lus10038180 [exp]	161.7	0.4787

Compare expression of checked genes

Lus10016621 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.