Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G25190 152 / 2e-47 AP2_ERF ESE3 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) AT1G15360 84 / 2e-20 AP2_ERF WIN1, SHN1 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) AT5G25390 80 / 7e-19 AP2_ERF SHN3, SHN2 shine3, Integrase-type DNA-binding superfamily protein (.1.2) AT5G11190 79 / 2e-18 AP2_ERF SHN2, SHN3 shine2, Integrase-type DNA-binding superfamily protein (.1) AT1G22190 70 / 1e-14 AP2_ERF RAP2.4 related to AP2 4, Integrase-type DNA-binding superfamily protein (.1) AT1G36060 69 / 6e-14 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT1G78080 68 / 8e-14 AP2_ERF CAF1, RAP2.4, WIND1 wound induced dedifferentiation 1, related to AP2 4 (.1) AT4G13620 68 / 1e-13 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G39780 67 / 2e-13 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT2G22200 66 / 2e-13 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035859 [exp] 257 / 1e-88 AT5G25190 196 / 9e-65 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10041023 [exp] 144 / 1e-43 AT5G25190 205 / 7e-68 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10005343 [exp] 112 / 9e-32 AT5G25190 174 / 3e-56 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10005716 [exp] 84 / 3e-20 AT1G15360 236 / 3e-79 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10030097 [exp] 84 / 5e-20 AT1G15360 234 / 1e-78 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10009480 [exp] 82 / 6e-20 AT1G15360 207 / 1e-68 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10041614 [exp] 82 / 2e-19 AT5G25190 165 / 1e-51 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10019414 [exp] 82 / 2e-19 AT1G15360 207 / 1e-67 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10002015 [exp] 75 / 4e-17 AT1G15360 183 / 4e-59 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G021900 [exp] 162 / 5e-51 AT5G25190 169 / 1e-53 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.006G261200 [exp] 161 / 1e-50 AT5G25190 169 / 9e-54 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.001G048200 [exp] 146 / 6e-45 AT5G25190 162 / 5e-51 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.018G131400 [exp] 84 / 4e-20 AT1G15360 194 / 6e-63 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.006G069400 [exp] 82 / 2e-19 AT1G15360 186 / 9e-60 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.003G033000 [exp] 81 / 2e-19 AT1G15360 181 / 3e-58 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.018G028000 [exp] 81 / 2e-19 AT5G11190 204 / 8e-68 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.006G253800 [exp] 81 / 4e-19 AT5G11190 197 / 1e-64 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.003G179900 [exp] 79 / 9e-19 AT5G25190 100 / 1e-26 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.002G167400 [exp] 67 / 2e-13 AT4G27950 162 / 3e-47 cytokinin response factor 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10016815 pacid=23149063 polypeptide=Lus10016815 locus=Lus10016815.g ID=Lus10016815.BGIv1.0 annot-version=v1.0 ATGGCGAGACCACAACAACGATACCGAGGCGTTCGACAGCGGCACTGGGGCTCCTGGGTTTCCGAAATTCGCCACCCATTATTGAAGACTAGAATCTGGC TAGGCACATTCGAGACGGCTGAGGATGCAGCTCGAGCTTACGACCAAGCCGCTAGGCTGATGTGCGGGCCAAGAGCAAGGACCAATTTCGTCCCAAATCA TGTGCCGAGTACTCATTCCGCTTCCTCAAAGCTCCTACTCTCTGCCAATCTCACTGCCAAATTGCATAGGTGCTACATGGCTTCCTTGCAAATCACCACA AAATCCCAAACCAAGGACATCATGATGATTTCAGCGAAAAGGGAGGAAACGGGCAGAGTGCAATTGGGAGCAGAGTCCAATTGGGACAGTATGAAGAAAG TTGATGATGTACTGGTTAACGACATGAACAACCAGCAGCCATTGGAGGATCATCACATTGAACAAATGATACAAGAGCTGCTTCATTATGGCTCCATTGA GCTCTCTTCTTCCACCCTTTCACCTAACTCTCTTTAA
AA sequence Show only first row Show all	>Lus10016815 pacid=23149063 polypeptide=Lus10016815 locus=Lus10016815.g ID=Lus10016815.BGIv1.0 annot-version=v1.0 MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAARAYDQAARLMCGPRARTNFVPNHVPSTHSASSKLLLSANLTAKLHRCYMASLQITT KSQTKDIMMISAKREETGRVQLGAESNWDSMKKVDDVLVNDMNNQQPLEDHHIEQMIQELLHYGSIELSSSTLSPNSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G25190	AP2_ERF	ESE3	ethylene and salt inducible 3,...		Lus10016815 [exp]	0	1
AT3G23150		ETR2	ethylene response 2, Signal tr...		Lus10022203 [exp]	2.2	0.9307
AT1G74670		GASA6	GA-stimulated Arabidopsis 6, G...		Lus10018016 [exp]	3.5	0.9146
AT1G59740			Major facilitator superfamily ...		Lus10007437 [exp]	7.1	0.8793
AT3G63440		ATCKX6, CKX6, A...	CYTOKININ OXIDASE 6, cytokinin...		Lus10005317 [exp]	10.4	0.8955
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10017013 [exp]	13.0	0.8754
AT4G24910			Protein of unknown function (D...		Lus10002345 [exp]	15.5	0.9064
AT1G06780		GAUT6	galacturonosyltransferase 6 (....		Lus10024859 [exp]	16.6	0.9063
AT2G34700			Pollen Ole e 1 allergen and ex...		Lus10014013 [exp]	17.5	0.8904
					Lus10041251 [exp]	17.8	0.9024
AT2G37900			Major facilitator superfamily ...		Lus10012663 [exp]	20.1	0.8998

Compare expression of checked genes

Lus10016815 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.