Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G11500 150 / 3e-49 Small nuclear ribonucleoprotein family protein (.1) AT2G23930 147 / 3e-48 SNRNP-G probable small nuclear ribonucleoprotein G (.1.2) AT2G03870 58 / 1e-12 EMB2816 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) AT3G14080 54 / 1e-10 Small nuclear ribonucleoprotein family protein (.1.2) AT1G19120 48 / 1e-08 Small nuclear ribonucleoprotein family protein (.1) AT3G59810 40 / 1e-05 Small nuclear ribonucleoprotein family protein (.1) AT1G65700 39 / 4e-05 Small nuclear ribonucleoprotein family protein (.1.2.3) AT2G43810 37 / 0.0002 Small nuclear ribonucleoprotein family protein (.1.2) AT5G44500 37 / 0.0004 Small nuclear ribonucleoprotein family protein (.1.2) AT4G20440 37 / 0.0005 SMB small nuclear ribonucleoprotein associated protein B (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021342 [exp] 158 / 2e-52 AT3G11500 152 / 3e-50 Small nuclear ribonucleoprotein family protein (.1) Lus10035639 [exp] 56 / 8e-12 AT2G03870 179 / 3e-60 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Lus10008124 [exp] 49 / 5e-09 AT3G14080 236 / 3e-82 Small nuclear ribonucleoprotein family protein (.1.2) Lus10042884 [exp] 39 / 3e-05 AT1G65700 158 / 7e-52 Small nuclear ribonucleoprotein family protein (.1.2.3) Lus10013108 [exp] 40 / 6e-05 AT5G44500 269 / 5e-91 Small nuclear ribonucleoprotein family protein (.1.2) Lus10011877 [exp] 38 / 0.0001 AT5G48870 169 / 8e-56 SUPERSENSITIVE TO ABA AND DROUGHT 1, Small nuclear ribonucleoprotein family protein (.1) Lus10022810 [exp] 37 / 0.0002 AT5G48870 167 / 8e-56 SUPERSENSITIVE TO ABA AND DROUGHT 1, Small nuclear ribonucleoprotein family protein (.1) Lus10026860 [exp] 38 / 0.0003 AT5G36890 189 / 2e-56 beta glucosidase 42 (.1.2) Lus10023386 [exp] 37 / 0.0006 AT5G44500 259 / 5e-87 Small nuclear ribonucleoprotein family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G211100 [exp] 153 / 1e-50 AT3G11500 153 / 2e-50 Small nuclear ribonucleoprotein family protein (.1) Potri.016G078100 [exp] 150 / 1e-49 AT3G11500 152 / 5e-50 Small nuclear ribonucleoprotein family protein (.1) Potri.001G269500 [exp] 58 / 9e-13 AT2G03870 183 / 8e-62 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Potri.009G064000 [exp] 58 / 9e-13 AT2G03870 183 / 8e-62 EMBRYO DEFECTIVE 2816, Small nuclear ribonucleoprotein family protein (.1.2) Potri.003G068400 [exp] 50 / 4e-09 AT3G14080 234 / 3e-81 Small nuclear ribonucleoprotein family protein (.1.2) Potri.001G166600 [exp] 49 / 7e-09 AT3G14080 233 / 9e-81 Small nuclear ribonucleoprotein family protein (.1.2) Potri.001G278000 [exp] 41 / 6e-06 AT1G65700 146 / 3e-47 Small nuclear ribonucleoprotein family protein (.1.2.3) Potri.001G440100 [exp] 39 / 6e-05 AT4G20440 211 / 2e-67 small nuclear ribonucleoprotein associated protein B (.1.2.3.4) Potri.011G155700 [exp] 39 / 7e-05 AT4G20440 218 / 2e-70 small nuclear ribonucleoprotein associated protein B (.1.2.3.4) Potri.010G178700 [exp] 37 / 9e-05 AT2G43810 150 / 4e-49 Small nuclear ribonucleoprotein family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0527 [flax] [poplar] Sm-like PF01423 [flax] [poplar] LSM LSM domain
Representative CDS sequence Show only first row Show all	>Lus10017019 pacid=23173034 polypeptide=Lus10017019 locus=Lus10017019.g ID=Lus10017019.BGIv1.0 annot-version=v1.0 ATGAGCAGATCCGGTCAGCCTCCGGATTTGAAGAAGTACATGGATAAGAAGCTTCAGATCAAGCTGAACGCGAACAGAATGGTGGTCGGAACACTGCGTG GCTTTGACCAGTTCATGAACTTGGTCATCGACAACACCGTGGAGGTGAACGGTGAAGAGAAAACTGAAATAGGGATGGTGGTGATAAGAGGAAATAGCGT GGTGACTGTGGAAGCTCTGGAGCCTGTAAACAGAGGGATATAG
AA sequence Show only first row Show all	>Lus10017019 pacid=23173034 polypeptide=Lus10017019 locus=Lus10017019.g ID=Lus10017019.BGIv1.0 annot-version=v1.0 MSRSGQPPDLKKYMDKKLQIKLNANRMVVGTLRGFDQFMNLVIDNTVEVNGEEKTEIGMVVIRGNSVVTVEALEPVNRGI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G11500			Small nuclear ribonucleoprotei...		Lus10017019 [exp]	0	1
AT5G56670			Ribosomal protein S30 family p...		Lus10017473 [exp]	1.0	0.9635
AT3G11500			Small nuclear ribonucleoprotei...		Lus10021342 [exp]	2.0	0.9263
AT1G61700			RNA polymerases N / 8 kDa subu...		Lus10008095 [exp]	5.2	0.8734
AT3G25210			Tetratricopeptide repeat (TPR)...		Lus10038215 [exp]	5.3	0.9001
AT2G33370			Ribosomal protein L14p/L23e fa...		Lus10011773 [exp]	5.7	0.9163
AT2G01640			unknown protein		Lus10002816 [exp]	6.2	0.8924
AT2G20450			Ribosomal protein L14 (.1)		Lus10008246 [exp]	7.5	0.9131
AT5G50810		TIM8	translocase inner membrane sub...		Lus10022450 [exp]	7.7	0.9129
AT5G09500			Ribosomal protein S19 family p...		Lus10021886 [exp]	7.7	0.9015
AT2G44860			Ribosomal protein L24e family ...		Lus10020552 [exp]	8.1	0.9009

Compare expression of checked genes

Lus10017019 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.