Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G34960 181 / 1e-55 CAT5 cationic amino acid transporter 5 (.1) AT4G21120 134 / 8e-38 CAT1, AAT1 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) AT1G17120 130 / 2e-36 CAT8 cationic amino acid transporter 8 (.1) AT3G10600 112 / 3e-30 CAT7 cationic amino acid transporter 7 (.1) AT5G04770 108 / 9e-29 CAT6, ATCAT6 ARABIDOPSIS THALIANA CATIONIC AMINO ACID TRANSPORTER 6, cationic amino acid transporter 6 (.1) AT1G05940 84 / 4e-20 CAT9 cationic amino acid transporter 9 (.1) AT1G58030 76 / 3e-17 CAT2 cationic amino acid transporter 2 (.1) AT5G36940 74 / 2e-16 CAT3 cationic amino acid transporter 3 (.1) AT3G03720 69 / 7e-15 CAT4 cationic amino acid transporter 4 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005574 [exp] 157 / 3e-46 AT1G17120 811 / 0.0 cationic amino acid transporter 8 (.1) Lus10001581 [exp] 130 / 3e-36 AT4G21120 915 / 0.0 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Lus10023271 [exp] 129 / 4e-36 AT4G21120 902 / 0.0 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Lus10000962 [exp] 106 / 8e-28 AT5G04770 543 / 0.0 ARABIDOPSIS THALIANA CATIONIC AMINO ACID TRANSPORTER 6, cationic amino acid transporter 6 (.1) Lus10040142 [exp] 106 / 8e-28 AT5G04770 547 / 0.0 ARABIDOPSIS THALIANA CATIONIC AMINO ACID TRANSPORTER 6, cationic amino acid transporter 6 (.1) Lus10042817 [exp] 104 / 4e-27 AT4G21120 731 / 0.0 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Lus10003697 [exp] 100 / 1e-25 AT4G21120 416 / 2e-140 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Lus10042898 [exp] 82 / 2e-19 AT1G05940 763 / 0.0 cationic amino acid transporter 9 (.1) Lus10028195 [exp] 80 / 2e-18 AT1G05940 763 / 0.0 cationic amino acid transporter 9 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G154600 [exp] 194 / 3e-60 AT2G34960 870 / 0.0 cationic amino acid transporter 5 (.1) Potri.001G378500 [exp] 142 / 6e-41 AT1G17120 785 / 0.0 cationic amino acid transporter 8 (.1) Potri.013G030900 [exp] 127 / 3e-35 AT4G21120 833 / 0.0 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Potri.013G030833 [exp] 127 / 3e-35 AT4G21120 833 / 0.0 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Potri.012G131300 [exp] 126 / 3e-35 AT4G21120 848 / 0.0 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Potri.015G133100 [exp] 123 / 6e-34 AT4G21120 845 / 0.0 CATIONIC AMINO ACID TRANSPORTER 1, amino acid transporter 1 (.1) Potri.001G150700 [exp] 104 / 3e-27 AT5G04770 519 / 2e-179 ARABIDOPSIS THALIANA CATIONIC AMINO ACID TRANSPORTER 6, cationic amino acid transporter 6 (.1) Potri.008G017100 [exp] 102 / 1e-26 AT3G10600 778 / 0.0 cationic amino acid transporter 7 (.1) Potri.010G241000 [exp] 102 / 2e-26 AT3G10600 781 / 0.0 cationic amino acid transporter 7 (.1) Potri.003G083700 [exp] 100 / 2e-25 AT5G04770 509 / 7e-176 ARABIDOPSIS THALIANA CATIONIC AMINO ACID TRANSPORTER 6, cationic amino acid transporter 6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0062 [flax] [poplar] APC PF00324 [flax] [poplar] AA_permease Amino acid permease
Representative CDS sequence Show only first row Show all	>Lus10018691 pacid=23176167 polypeptide=Lus10018691 locus=Lus10018691.g ID=Lus10018691.BGIv1.0 annot-version=v1.0 ATGATCAGCACAAGGAAAACATCATTACTCAACTGGGTAGCAACTGTTCTGAATACTGCAGTCATTTTGTTTGTAATAGTTGCAGGTTTTGCCCATGCCC AGCCATCCAATCTCTCCCCTTTTCTTCCTTACGGCGTTAAAGGAGTCTTCCAAGCAGCTGCAATCGTCTACTTTGCCTATGGAGGATTTGACAATATAGC CACCATGGCAGAAGAAACCAAAAACCCCTCCAGAGACATACCATTAGGATTGCTTGGCTCCATGTCCATGATTACAGTGATCTACTGTTTAATGGCGCTT TCGCTGTCGATGACGCAAAACCTAAGCAAAACCTCGTCAAGTTGGTGA
AA sequence Show only first row Show all	>Lus10018691 pacid=23176167 polypeptide=Lus10018691 locus=Lus10018691.g ID=Lus10018691.BGIv1.0 annot-version=v1.0 MISTRKTSLLNWVATVLNTAVILFVIVAGFAHAQPSNLSPFLPYGVKGVFQAAAIVYFAYGGFDNIATMAEETKNPSRDIPLGLLGSMSMITVIYCLMAL SLSMTQNLSKTSSSW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G34960		CAT5	cationic amino acid transporte...		Lus10018691 [exp]	0	1
AT4G33490			Eukaryotic aspartyl protease f...		Lus10020874 [exp]	3.9	0.8100
AT5G38290			Peptidyl-tRNA hydrolase family...		Lus10031327 [exp]	8.4	0.8388
AT5G65550			UDP-Glycosyltransferase superf...		Lus10008956 [exp]	9.8	0.8158
AT5G02710			unknown protein		Lus10015040 [exp]	9.9	0.7907
					Lus10030382 [exp]	11.0	0.7609
AT1G54730			Major facilitator superfamily ...		Lus10029964 [exp]	12.7	0.8214
AT3G05370		AtRLP31	receptor like protein 31 (.1)		Lus10019692 [exp]	12.7	0.8071
					Lus10033476 [exp]	14.7	0.8143
AT4G03230			S-locus lectin protein kinase ...		Lus10033752 [exp]	21.4	0.7724
AT3G13040	GARP		myb-like HTH transcriptional r...		Lus10040569 [exp]	21.9	0.7777

Compare expression of checked genes

Lus10018691 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.