Lus10018727 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G67190 157 / 5e-49 AP2_ERF DEAR2 DREB and EAR motif protein 2 (.1)
AT1G46768 151 / 2e-47 AP2_ERF RAP2.1 related to AP2 1 (.1)
AT3G50260 149 / 1e-46 AP2_ERF DEAR1, CEJ1, ATERF#011 DREB AND EAR MOTIF PROTEIN 1, cooperatively regulated by ethylene and jasmonate 1 (.1)
AT2G23340 150 / 2e-46 AP2_ERF DEAR3 DREB and EAR motif protein 3 (.1)
AT4G06746 145 / 7e-45 AP2_ERF DEAR5, RAP2.9 DREB AND EAR MOTIF PROTEIN 5, related to AP2 9 (.1)
AT4G36900 145 / 2e-44 AP2_ERF DEAR4, RAP2.10 DREB AND EAR MOTIF PROTEIN 4, related to AP2 10 (.1)
AT4G16750 99 / 2e-26 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT1G71450 95 / 7e-25 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT2G44940 97 / 1e-24 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
AT2G35700 94 / 1e-24 AP2_ERF ATERF38 ERF family protein 38 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010043 174 / 2e-56 AT2G23340 170 / 1e-54 DREB and EAR motif protein 3 (.1)
Lus10009373 162 / 2e-51 AT5G67190 164 / 3e-52 DREB and EAR motif protein 2 (.1)
Lus10033420 96 / 6e-25 AT1G19210 181 / 4e-58 Integrase-type DNA-binding superfamily protein (.1)
Lus10009798 93 / 4e-24 AT1G19210 132 / 1e-39 Integrase-type DNA-binding superfamily protein (.1)
Lus10038082 94 / 5e-24 AT5G21960 155 / 3e-47 Integrase-type DNA-binding superfamily protein (.1)
Lus10002801 94 / 9e-24 AT5G11590 209 / 4e-68 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Lus10001601 92 / 2e-23 AT5G11590 159 / 1e-48 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Lus10019665 92 / 3e-23 AT4G39780 209 / 1e-67 Integrase-type DNA-binding superfamily protein (.1)
Lus10043240 91 / 2e-22 AT5G11590 176 / 1e-54 TINY2, Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G025200 195 / 1e-64 AT1G46768 160 / 3e-51 related to AP2 1 (.1)
Potri.002G124000 191 / 9e-63 AT1G46768 158 / 3e-50 related to AP2 1 (.1)
Potri.005G140900 160 / 2e-50 AT5G67190 169 / 1e-53 DREB and EAR motif protein 2 (.1)
Potri.007G046500 154 / 4e-48 AT5G67190 149 / 7e-46 DREB and EAR motif protein 2 (.1)
Potri.013G101100 99 / 1e-26 AT1G71450 184 / 1e-59 Integrase-type DNA-binding superfamily protein (.1)
Potri.018G038100 97 / 4e-26 AT5G21960 100 / 5e-27 Integrase-type DNA-binding superfamily protein (.1)
Potri.003G079300 99 / 8e-26 AT4G16750 150 / 7e-46 Integrase-type DNA-binding superfamily protein (.1)
Potri.006G138900 97 / 9e-26 AT5G21960 86 / 3e-21 Integrase-type DNA-binding superfamily protein (.1)
Potri.018G047300 95 / 1e-24 AT1G19210 169 / 1e-53 Integrase-type DNA-binding superfamily protein (.1)
Potri.013G100300 93 / 2e-24 AT1G22810 140 / 5e-43 Integrase-type DNA-binding superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0081 MBD-like PF00847 AP2 AP2 domain
Representative CDS sequence
>Lus10018727 pacid=23176288 polypeptide=Lus10018727 locus=Lus10018727.g ID=Lus10018727.BGIv1.0 annot-version=v1.0
ATGGAGGGCCGACTCTGCTGTTCCAGTGATTCAAATTCAACCTCCTCTTCCACGGCGGAGAAGCGGAAGCACTGCGGCGGAGGAGAGAAGCCGTACAGAG
GAATAAGGATGAGGAAGTGGGGGAAGTGGGTGGCCGAGATTAGGGAGCCCAACAAGCGGTCCAGAATTTGGTTGGGCTCTTACTCTACCCCTATCGCCGC
CGCACGTGCCTACGACACAGCCGTCTTCTATCTTCGTGGCCCCACCGCCCGCCTCAATTTCCCGGACTTGATTTACCAAGACGACCACCTCCCAAACGAC
GACGTCTCCGCCGCCTCTATCCGTAAGAAAGCCACCGAGGTTGGTGCTAAAGTCGACGCCTTCCAGACCTCCCTTCACCACCACGCCGCCGCAGACGACG
ACGACAGCCACGTCTCCAACACCGCCGCCGCCTCTCCCGCCGCCGCCGCCGCCAGGCCGGCCCAGCAGAAACCCGATTTGAACGAGTACCCGGAAAATTC
GGACGAGGATGACGAATAA
AA sequence
>Lus10018727 pacid=23176288 polypeptide=Lus10018727 locus=Lus10018727.g ID=Lus10018727.BGIv1.0 annot-version=v1.0
MEGRLCCSSDSNSTSSSTAEKRKHCGGGEKPYRGIRMRKWGKWVAEIREPNKRSRIWLGSYSTPIAAARAYDTAVFYLRGPTARLNFPDLIYQDDHLPND
DVSAASIRKKATEVGAKVDAFQTSLHHHAAADDDDSHVSNTAAASPAAAAARPAQQKPDLNEYPENSDEDDE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G67190 AP2_ERF DEAR2 DREB and EAR motif protein 2 (... Lus10018727 0 1
AT1G03350 BSD domain-containing protein ... Lus10012761 4.2 0.8548
AT4G11680 Zinc finger, C3HC4 type (RING ... Lus10006313 4.7 0.8505
AT3G09880 ATB' BETA, ATB'... Protein phosphatase 2A regulat... Lus10021511 6.9 0.8493
AT5G52190 Sugar isomerase (SIS) family p... Lus10014993 8.9 0.8447
AT5G05610 Alfin AL1 alfin-like 1 (.1.2) Lus10027805 10.1 0.7524
AT1G03140 splicing factor Prp18 family p... Lus10042599 10.6 0.8239
AT3G17770 Dihydroxyacetone kinase (.1) Lus10031879 10.9 0.8313
AT3G15358 unknown protein Lus10011176 11.0 0.8416
AT3G10740 ATASD1, ARAF1, ... ARABIDOPSIS THALIANA ALPHA-L-A... Lus10038988 12.2 0.8377
AT5G54540 Uncharacterised conserved prot... Lus10003594 15.0 0.8222

Lus10018727 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.