Lus10018758 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G79800 142 / 3e-43 AtENODL7 early nodulin-like protein 7 (.1)
AT3G20570 96 / 4e-25 AtENODL9 early nodulin-like protein 9 (.1)
AT5G14345 93 / 2e-24 AtENODL21 early nodulin-like protein 21 (.1)
AT1G48940 93 / 6e-24 AtENODL6 early nodulin-like protein 6 (.1)
AT3G18590 90 / 1e-22 AtENODL5 early nodulin-like protein 5 (.1)
AT2G25060 86 / 4e-21 AtENODL14 early nodulin-like protein 14 (.1)
AT5G53870 87 / 1e-20 AtENODL1 early nodulin-like protein 1 (.1)
AT5G57920 84 / 2e-20 AtENODL10 early nodulin-like protein 10 (.1)
AT4G31840 82 / 8e-20 AtENODL15 early nodulin-like protein 15 (.1)
AT4G27520 83 / 5e-19 AtENODL2 early nodulin-like protein 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024846 272 / 4e-94 AT1G79800 147 / 1e-44 early nodulin-like protein 7 (.1)
Lus10037575 152 / 4e-47 AT1G79800 127 / 4e-37 early nodulin-like protein 7 (.1)
Lus10011433 151 / 1e-46 AT1G79800 124 / 4e-36 early nodulin-like protein 7 (.1)
Lus10026880 93 / 8e-24 AT5G25090 167 / 8e-53 early nodulin-like protein 13 (.1)
Lus10003432 92 / 3e-23 AT5G25090 167 / 5e-53 early nodulin-like protein 13 (.1)
Lus10014880 92 / 3e-23 AT3G18590 144 / 1e-43 early nodulin-like protein 5 (.1)
Lus10032111 90 / 6e-23 AT5G14345 147 / 1e-45 early nodulin-like protein 21 (.1)
Lus10022318 89 / 4e-22 AT3G18590 146 / 4e-45 early nodulin-like protein 5 (.1)
Lus10009617 83 / 5e-20 AT3G18590 148 / 1e-45 early nodulin-like protein 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G187700 170 / 4e-54 AT1G79800 176 / 2e-56 early nodulin-like protein 7 (.1)
Potri.003G050500 159 / 1e-49 AT1G79800 162 / 1e-50 early nodulin-like protein 7 (.1)
Potri.011G117800 97 / 2e-24 AT5G53870 158 / 3e-45 early nodulin-like protein 1 (.1)
Potri.011G135400 94 / 5e-24 AT3G20570 138 / 4e-41 early nodulin-like protein 9 (.1)
Potri.006G184100 92 / 8e-24 AT4G31840 174 / 5e-56 early nodulin-like protein 15 (.1)
Potri.006G264600 89 / 1e-22 AT2G25060 184 / 9e-60 early nodulin-like protein 14 (.1)
Potri.015G052000 88 / 4e-22 AT1G48940 163 / 1e-51 early nodulin-like protein 6 (.1)
Potri.018G018200 87 / 1e-21 AT2G25060 177 / 7e-57 early nodulin-like protein 14 (.1)
Potri.001G338800 86 / 2e-21 AT5G14345 145 / 6e-45 early nodulin-like protein 21 (.1)
Potri.001G398800 88 / 7e-21 AT4G28365 145 / 9e-42 early nodulin-like protein 3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10018758 pacid=23176199 polypeptide=Lus10018758 locus=Lus10018758.g ID=Lus10018758.BGIv1.0 annot-version=v1.0
ATGTACTCTGCTGCTGCAAAAGTGTTCAAAGTCGGCGACGATTTCGGCTGGCAACAACCATCTAACAACAACTCCCAGATTTATCCTCAGTGGGCCACCT
CCAACAGATTCCAAGTCGGGGATTCCCTCTTGTTCGAGTACAAGAACGACTCAGTAGCACAAGTGGACAAATGGGGATACTACCACTGCAACATCACCAG
CTCGTCAATGGCGGTTTTCGACAATGGAAGGAGCACTTTCAAGCTTGACCAGCCTGGACCTTTCTACTTCATCAGTGGCAACATCAACCACTGTCACAAC
GGACAGCTTCTTCTGGTAGAAGTTATGTCAACTCACCATACTTACCATCCCACCATGGCGCCTTATCCTTCGGCCTTTCCTCCGAGTTACATGAATCCCC
CGGAGGGGTCTTCATCATCATCACTAGATGATGATGATCAGCCAAACTTGGCAGCCATTGTTTCGGTTGTATCGAGTTCAGTGGCCGTTGTTCTTATTGC
CACATTTGTTGCTTTGGCATGGTGTGCACCATGA
AA sequence
>Lus10018758 pacid=23176199 polypeptide=Lus10018758 locus=Lus10018758.g ID=Lus10018758.BGIv1.0 annot-version=v1.0
MYSAAAKVFKVGDDFGWQQPSNNNSQIYPQWATSNRFQVGDSLLFEYKNDSVAQVDKWGYYHCNITSSSMAVFDNGRSTFKLDQPGPFYFISGNINHCHN
GQLLLVEVMSTHHTYHPTMAPYPSAFPPSYMNPPEGSSSSSLDDDDQPNLAAIVSVVSSSVAVVLIATFVALAWCAP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G79800 AtENODL7 early nodulin-like protein 7 (... Lus10018758 0 1
AT2G23570 ATMES19 ARABIDOPSIS THALIANA METHYL ES... Lus10020004 1.0 0.9186
Lus10034724 3.2 0.8760
AT3G22640 PAP85 cupin family protein (.1) Lus10042615 6.0 0.8577
AT5G49690 UDP-Glycosyltransferase superf... Lus10002351 9.5 0.8888
AT3G25810 Terpenoid cyclases/Protein pre... Lus10031352 12.0 0.8356
AT3G52080 CHX28 cation/hydrogen exchanger 28 (... Lus10019716 12.1 0.8831
AT1G17400 unknown protein Lus10039921 16.1 0.8820
AT2G46410 MYB CPC CAPRICE, Homeodomain-like supe... Lus10007643 16.9 0.8101
Lus10013172 20.5 0.7583
AT3G63390 unknown protein Lus10018745 24.1 0.6738

Lus10018758 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.