Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G15360 164 / 7e-51 AP2_ERF WIN1, SHN1 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) AT5G25390 157 / 1e-48 AP2_ERF SHN3, SHN2 shine3, Integrase-type DNA-binding superfamily protein (.1.2) AT5G11190 150 / 1e-45 AP2_ERF SHN2, SHN3 shine2, Integrase-type DNA-binding superfamily protein (.1) AT5G25190 91 / 7e-23 AP2_ERF ESE3 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) AT4G11140 71 / 1e-14 AP2_ERF CRF1 cytokinin response factor 1 (.1) AT1G71450 68 / 6e-14 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT2G35700 67 / 8e-14 AP2_ERF ATERF38 ERF family protein 38 (.1) AT5G53290 69 / 1e-13 AP2_ERF CRF3 cytokinin response factor 3 (.1) AT1G77640 68 / 1e-13 AP2_ERF Integrase-type DNA-binding superfamily protein (.1) AT4G16750 67 / 1e-13 AP2_ERF Integrase-type DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043271 [exp] 236 / 4e-79 AT1G15360 160 / 2e-49 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10005716 [exp] 206 / 4e-67 AT1G15360 236 / 3e-79 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10030097 [exp] 203 / 5e-66 AT1G15360 234 / 1e-78 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10009480 [exp] 155 / 1e-47 AT1G15360 207 / 1e-68 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10002015 [exp] 139 / 2e-41 AT1G15360 183 / 4e-59 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Lus10002912 [exp] 135 / 5e-40 AT5G25390 187 / 6e-61 shine3, Integrase-type DNA-binding superfamily protein (.1.2) Lus10041023 [exp] 90 / 5e-22 AT5G25190 205 / 7e-68 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10016815 [exp] 85 / 2e-20 AT5G25190 206 / 1e-68 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Lus10005343 [exp] 83 / 4e-20 AT5G25190 174 / 3e-56 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G131400 [exp] 196 / 2e-63 AT1G15360 194 / 6e-63 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.006G069400 [exp] 185 / 4e-59 AT1G15360 186 / 9e-60 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.018G028000 [exp] 155 / 6e-48 AT5G11190 204 / 8e-68 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.003G033000 [exp] 154 / 2e-47 AT1G15360 181 / 3e-58 WAX INDUCER 1, SHINE 1, Integrase-type DNA-binding superfamily protein (.1) Potri.006G253800 [exp] 152 / 3e-46 AT5G11190 197 / 1e-64 shine2, Integrase-type DNA-binding superfamily protein (.1) Potri.001G048200 [exp] 88 / 1e-21 AT5G25190 162 / 5e-51 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.006G261200 [exp] 87 / 3e-21 AT5G25190 169 / 9e-54 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.018G021900 [exp] 87 / 3e-21 AT5G25190 169 / 1e-53 ethylene and salt inducible 3, Integrase-type DNA-binding superfamily protein (.1) Potri.013G101100 [exp] 67 / 7e-14 AT1G71450 184 / 1e-59 Integrase-type DNA-binding superfamily protein (.1) Potri.005G087200 [exp] 69 / 1e-13 AT2G33710 87 / 4e-20 Integrase-type DNA-binding superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0081 [flax] [poplar] MBD-like PF00847 [flax] [poplar] AP2 AP2 domain
Representative CDS sequence Show only first row Show all	>Lus10019414 pacid=23181505 polypeptide=Lus10019414 locus=Lus10019414.g ID=Lus10019414.BGIv1.0 annot-version=v1.0 ATGGTGCAATCAAGGAAGTTCAGAGGCGTTAGGCAGCGTCAGTGGGGCTCTTGGGTTTCCGAAATTCGACACCCCTTATTGAAACGGAGGATCTGGCTAG GGACATTCGAGACGGCAGAGGAAGCTGCAAGAGCATACGACCAAGCCGCAATCCTAATGAGTGGCCGGAGCGCCAAGACCAACTTTCCCAACCCCGGTGA AACCAAACCCTTTTCTCCATCGCAACTTCAGAATAATGGGCTTTCGGAAGTACTCCAAGCCAAGCTCCGGAGGAGCAGTAAGAAGCCTTCGCCGTCGATG ACGTGCCTGAGGCTGGACACCGAGAACTCTCACATTGGGTTGTGGCAGACACGCGCCGGGAAGAGGTCGGATTCCAATTGGGTTATGATGGTGAAAATGG AAGGAGACCGATCTCCGTCGTCATCGGAAGTAAACCAGGCGAAGGTAGGAAGAGTCGAGGACATTGTCATCAACAGCACAGATGAGAATTCGGGAATACA GACGCTGGCAGTTCCGGTATCAGGAATCAGAAGGGAAATGGAGGAAGAAGAGAGCATAGCACTGCAGATGATTGATGAGCTGCTGATTCGGAATTTCCCT AGTCCGAGTGGCGGCATTGGTGTCCGAACGACGGCCGCGGCGGTGGAAAAAGGAAGGGAAGAGCTGAATTAG
AA sequence Show only first row Show all	>Lus10019414 pacid=23181505 polypeptide=Lus10019414 locus=Lus10019414.g ID=Lus10019414.BGIv1.0 annot-version=v1.0 MVQSRKFRGVRQRQWGSWVSEIRHPLLKRRIWLGTFETAEEAARAYDQAAILMSGRSAKTNFPNPGETKPFSPSQLQNNGLSEVLQAKLRRSSKKPSPSM TCLRLDTENSHIGLWQTRAGKRSDSNWVMMVKMEGDRSPSSSEVNQAKVGRVEDIVINSTDENSGIQTLAVPVSGIRREMEEEESIALQMIDELLIRNFP SPSGGIGVRTTAAAVEKGREELN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G15360	AP2_ERF	WIN1, SHN1	WAX INDUCER 1, SHINE 1, Integr...		Lus10019414 [exp]	0	1
AT3G52500			Eukaryotic aspartyl protease f...		Lus10016967 [exp]	2.8	0.8789
AT3G25140		QUA1, GAUT8	QUASIMODO 1, GALACTURONOSYLTRA...		Lus10011834 [exp]	3.7	0.8689
AT5G19780		TUA5	tubulin alpha-5 (.1)		Lus10020281 [exp]	4.9	0.8630
AT1G66830			Leucine-rich repeat protein ki...		Lus10017611 [exp]	7.7	0.8661
AT3G25140		QUA1, GAUT8	QUASIMODO 1, GALACTURONOSYLTRA...		Lus10022767 [exp]	8.9	0.8593
AT5G07620			Protein kinase superfamily pro...		Lus10042988 [exp]	10.6	0.7993
AT1G10950		AtTMN1	transmembrane nine 1 (.1)		Lus10015463 [exp]	10.7	0.8647
AT4G12520			Bifunctional inhibitor/lipid-t...		Lus10028928 [exp]	11.5	0.8309
AT3G12110		ACT11	actin-11 (.1)		Lus10021057 [exp]	11.5	0.8588
AT5G16730			Plant protein of unknown funct...		Lus10020373 [exp]	13.4	0.8157

Compare expression of checked genes

Lus10019414 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.