Lus10019955 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G25090 111 / 4e-31 AtENODL13 early nodulin-like protein 13 (.1)
AT5G57920 110 / 5e-31 AtENODL10 early nodulin-like protein 10 (.1)
AT2G25060 109 / 2e-30 AtENODL14 early nodulin-like protein 14 (.1)
AT4G30590 109 / 2e-30 AtENODL12 early nodulin-like protein 12 (.1)
AT3G20570 103 / 6e-28 AtENODL9 early nodulin-like protein 9 (.1)
AT4G31840 100 / 3e-27 AtENODL15 early nodulin-like protein 15 (.1)
AT2G23990 99 / 5e-26 AtENODL11 early nodulin-like protein 11 (.1.2)
AT4G27520 84 / 2e-19 AtENODL2 early nodulin-like protein 2 (.1)
AT4G32490 77 / 8e-18 AtENODL4 early nodulin-like protein 4 (.1)
AT5G53870 77 / 4e-17 AtENODL1 early nodulin-like protein 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036257 139 / 3e-42 AT2G25060 110 / 3e-31 early nodulin-like protein 14 (.1)
Lus10003432 110 / 2e-30 AT5G25090 167 / 5e-53 early nodulin-like protein 13 (.1)
Lus10026880 108 / 4e-30 AT5G25090 167 / 8e-53 early nodulin-like protein 13 (.1)
Lus10022160 96 / 7e-26 AT2G25060 76 / 5e-18 early nodulin-like protein 14 (.1)
Lus10018617 86 / 6e-21 AT4G28365 150 / 5e-46 early nodulin-like protein 3 (.1)
Lus10043063 82 / 1e-19 AT3G20570 153 / 4e-47 early nodulin-like protein 9 (.1)
Lus10039852 81 / 2e-19 AT4G28365 150 / 8e-46 early nodulin-like protein 3 (.1)
Lus10011158 81 / 4e-19 AT3G20570 149 / 2e-45 early nodulin-like protein 9 (.1)
Lus10009196 81 / 1e-18 AT5G53870 154 / 3e-44 early nodulin-like protein 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G018200 121 / 3e-35 AT2G25060 177 / 7e-57 early nodulin-like protein 14 (.1)
Potri.006G264600 119 / 2e-34 AT2G25060 184 / 9e-60 early nodulin-like protein 14 (.1)
Potri.006G184100 107 / 7e-30 AT4G31840 174 / 5e-56 early nodulin-like protein 15 (.1)
Potri.017G011200 86 / 6e-21 AT4G32490 157 / 2e-48 early nodulin-like protein 4 (.1)
Potri.011G135400 84 / 2e-20 AT3G20570 138 / 4e-41 early nodulin-like protein 9 (.1)
Potri.011G117800 80 / 6e-18 AT5G53870 158 / 3e-45 early nodulin-like protein 1 (.1)
Potri.001G419200 77 / 2e-17 AT3G20570 153 / 1e-46 early nodulin-like protein 9 (.1)
Potri.001G398800 76 / 1e-16 AT4G28365 145 / 9e-42 early nodulin-like protein 3 (.1)
Potri.006G259000 71 / 1e-15 AT5G26330 144 / 6e-44 Cupredoxin superfamily protein (.1)
Potri.002G161300 70 / 3e-15 AT5G26330 146 / 5e-45 Cupredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0026 CU_oxidase PF02298 Cu_bind_like Plastocyanin-like domain
Representative CDS sequence
>Lus10019955 pacid=23156155 polypeptide=Lus10019955 locus=Lus10019955.g ID=Lus10019955.BGIv1.0 annot-version=v1.0
ATGGCTCGTTTGATCTCCATACTCTGTCTCGTTTCCCTTGTCATCGCCGTTTCTGAAGCAAGGGAGATCGTCGTCGGAGGTAGAGAGAGCAAGACCTTCT
GGAGAGTTCCCGGCGGTAATCTTACAAATCTCGACTATTGGGCTGAACAACTCAGGTTCTCTCCCGGAGATGTTCTTGTATGGTATTTGGAGGCAAAAGA
GGGATCAGTGCTTCAAGTGAGCAAAGAAGCGTATGAAAGCTGCGACAAGACGAATCCGATCAAAGAACTGAAAGACGGCGTTGAAAAGGTGAGTTTGGAA
CGGTCGGGACCTTTTTACTTCATCAGTGGGAAGGAACCTGACTGCAAGAAAGGGATGAAGCTTGAAGTGGTCGTTCTAGCAGATCATCATCAGCAGCAGC
AGCGTCACTTACCTCCCTCTCCTGCTCCCTCGCCGTATTCTTCGAGTGCGTCGAAGGTCCTGAACTACCGATGTGCCACTGTTGTTGTAGCTGCTGCTGC
TGCAATGTTGATTTGA
AA sequence
>Lus10019955 pacid=23156155 polypeptide=Lus10019955 locus=Lus10019955.g ID=Lus10019955.BGIv1.0 annot-version=v1.0
MARLISILCLVSLVIAVSEAREIVVGGRESKTFWRVPGGNLTNLDYWAEQLRFSPGDVLVWYLEAKEGSVLQVSKEAYESCDKTNPIKELKDGVEKVSLE
RSGPFYFISGKEPDCKKGMKLEVVVLADHHQQQQRHLPPSPAPSPYSSSASKVLNYRCATVVVAAAAAMLI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G30590 AtENODL12 early nodulin-like protein 12 ... Lus10019955 0 1
Lus10007414 1.4 0.8420
AT2G48140 EDA4 embryo sac development arrest ... Lus10042613 2.4 0.8093
Lus10014650 4.9 0.8185
AT3G26040 HXXXD-type acyl-transferase fa... Lus10021387 6.9 0.6894
AT3G05950 RmlC-like cupins superfamily p... Lus10035280 8.2 0.7825
Lus10041736 9.2 0.6690
AT3G54320 AP2_ERF ATWRI1, ASML1, ... WRINKLED 1, WRINKLED, ACTIVATO... Lus10013268 9.2 0.7825
AT3G29590 AT5MAT HXXXD-type acyl-transferase fa... Lus10003345 10.1 0.7825
AT3G12500 PR-3, PR3, CHI-... PATHOGENESIS-RELATED 3, basic ... Lus10003585 10.9 0.7825
Lus10027457 11.3 0.7734

Lus10019955 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.